KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5529Help
Entry
SCAT_5529         CDS       T01646                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00010  Glycolysis / Gluconeogenesis
sct00071  Fatty acid degradation
sct00350  Tyrosine metabolism
sct00625  Chloroalkane and chloroalkene degradation
sct00626  Naphthalene degradation
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_5529
  Lipid metabolism
   00071 Fatty acid degradation
    SCAT_5529
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCAT_5529
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCAT_5529
   00626 Naphthalene degradation
    SCAT_5529
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCAT_5529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CCB78217
Position
complement(5942240..5943130)
Genome map
AA seq 296 aa AA seqDB search
MCGVCRTDLHLAEGDLPPRRPMCVPGHEIVGRVVEAGHAVRGFAPGDRVGAAWLAGTCGR
CAYCRSGRENLCPRSRYTGWDVDGGYAGHVLVDARYAYRPPAGWADDETAPLLCAGIIGY
RALCRAELPPGGRLGVYGFGASAHLTAQLALARGATVHVLTRGERARRLALDLGAASARD
AYETPPEPLDAAILFAPAGELVPVALAALDRGGTLAIAGIHLSAVPALDYRRHLFQERTV
RSVTANTREDGRAFLAEAARLRPSVRLTRYPMRRADRALADLAAGEVTGVAVLMAQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggggtctgccgcaccgatctccacctggccgagggtgacctgcccccgcgccgc
ccgatgtgcgtgcccggccacgagatcgtcgggcgggtggtcgaggccggccacgcggtg
cgcggcttcgcccccggcgaccgggtcggggccgcctggctggccggcacctgcggccgt
tgcgcctactgccggtcggggcgggagaacctgtgcccgcgttcccggtacaccggctgg
gacgtcgacggcgggtacgccggccacgtgctggtggacgcccgctacgcctaccggccc
ccggccggctgggcggacgacgagacggcgccgctgctgtgcgccggcatcatcggctac
cgcgccctgtgccgcgccgaactgccgcccggcggacgtctgggcgtctacgggttcggc
gcctccgcccatctgaccgcgcagctcgcgctggcccgcggcgccaccgtgcacgtgctc
acccgtggcgagcgggcccgccggctcgcgctcgacctgggcgcggcgtccgcccgggac
gcgtacgagacaccgccggagccgctggacgcggcgatcttgttcgcgcccgccggtgag
ctggtgccggtggcgctggccgcgctcgaccggggcggcaccctcgccatcgcgggcatc
cacctgtccgccgttcccgcgctggactaccggcgccatctgttccaggaacgtacggtg
cgcagcgtcaccgccaacacccgtgaggacggccgggcgttcctcgccgaggccgcccgg
ctgcgcccctccgtgcggctgacccgctatccgatgcgccgggccgaccgggcgctggcc
gacctggcggcgggcgaggtgacgggggtggcggtgctgatggcgcaatga

DBGET integrated database retrieval system