KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_p1047
Entry
SCAT_p1047        CDS       T01646                                 

Definition
(GenBank) protein of unknown function
  KO
K23670  4-chloro-allylglycine synthase [EC:1.14.99.-]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00997  Biosynthesis of various secondary metabolites - part 3
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
Module
sct_M00906  Ethynylserine biosynthesis, lysine => ethynylserine
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SCAT_p1047
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.-  
     SCAT_p1047
SSDB
Motif
Pfam: Haem_oxygenas_2 TENA_THI-4 DUF3865
Other DBs
NCBI-ProteinID: CCB72071
Position
pSCAT:complement(1129599..1130372)
AA seq 257 aa
MTDLNTPESTSKPVWEHFDHVEPGIRRRIAVADPEIKEYLDGMLARIASHRGVEHPFLNA
YRTTALDPEQERHLFSECYYFFRYLPFYITGMAVKTRDEMILREIILNVADEVGSDPTHS
TLFADFLARIGIDKEHLDGYQPLEVTRQLNDGIRHLYTETSINKALGALYADETMSSIMV
SKINDGLRNQGYDDDLRHFWQLHIDVEVGHSNSVFNAIAPYVGSKAARAEFEEGVFEFLG
LVERYWDGVRELVGIGK
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaccgacctgaacaccccggaatccacctcgaagccggtgtgggagcacttcgaccac
gtagagccgggaattcggcggcgcatcgccgtggccgacccggaaatcaaggaatacctg
gacggaatgctggcccggatcgcgtcccaccgcggcgtcgagcacccgttcctcaacgcc
taccgcaccacggcactcgacccggagcaggaacgccacctgttcagcgagtgctactac
ttcttccggtacctccccttctacatcacggggatggccgtcaagacgcgggacgagatg
atcctgcgggagatcatcctcaacgtggcggacgaggtcggcagcgacccgacgcactcc
acgctcttcgccgacttcctcgcccggatcggcatcgacaaggaacacctcgacggctac
cagccgctggaggtcacccggcagctcaacgacggcatccggcacctgtacaccgagacg
tcgatcaacaaggcgctcggcgcgctctacgccgacgagaccatgtcctccatcatggtc
tcgaagatcaacgacggcctgcgcaaccaggggtacgacgacgacctgcgccacttctgg
cagctccacatcgacgtcgaggtcggccacagcaactccgtcttcaacgcgatcgcaccg
tacgtcggatcgaaggcggcccgggccgagttcgaggagggcgtcttcgaattcctcgga
ctggtcgaacgctactgggacggcgtgcgggaactcgtgggcatcggcaagtga

DBGET integrated database retrieval system