KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_p1377Help
Entry
SCAT_p1377        CDS       T01646                                 

Definition
(GenBank) conserved exported protein of unknown function
  KO
K18058  L-asparagine oxygenase [EC:1.14.11.39]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
KEGG Orthology (KO) [BR:sct00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCAT_p1377
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.39  L-asparagine hydroxylase
     SCAT_p1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauD CsiD
Motif
Other DBs
NCBI-ProteinID: CCB72401
UniProt: F8JK98
Position
pSCAT:1456437..1457513
Genome map
AA seq 358 aa AA seqDB search
MTVIDHTTVTTTAATSAAASADATNNAPVRTLTEIVLPDAVRDAIGEQLAALPDPTTDID
LAMARYHQIFAGLPIGILQQMLDFGRHIDTAGVGYVRNLPVDRGLPDTPSDGGPSRDKAS
YVAEGVLLGLTGLLGEPVGFLTEKRGQLVHDVIPVAGGSMTQTNQGSTVFLNFHNDIVHD
SIGRYDVSNPDFLVLSCLRADHEGVAATYYADARDISRALDAGTLETLRSPVFRLNAPGS
YVREVAGGNDVLSDPVPVISGPDDSPEISVSANGVRAMTSGGQAALDRLQAACREVAHEV
FLRPGQALLINNRKGLHARSQFTARYDGADRWLQRTYVRRNQWSIRYRVTPDNRRVHF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcatcgaccacaccaccgtcaccaccaccgccgccacctctgccgccgcctcc
gccgacgccacgaacaacgccccggtgcgcacactcaccgagatcgtcctgccggacgcg
gtccgcgacgccatcggcgagcagctggccgccctccccgatccgacgaccgacatcgac
ctggcgatggcccgctaccaccagatcttcgccgggctgccgatcggcatcctccagcag
atgctcgacttcggccgccacatcgacaccgccggcgtcggctacgtccgcaacctcccc
gtcgaccgggggctccccgacaccccgtccgacggcggtcccagccgcgacaaggcgagc
tacgtcgccgaaggcgtcctgctgggactgaccgggctgctgggcgagccggtcggcttc
ctgaccgagaagcgcggccagctcgtccacgacgtgatcccggtggccggcggctcgatg
acccagaccaaccagggctccaccgtcttcctcaacttccacaacgacatcgtccacgac
tccataggccgctacgacgtcagcaaccccgacttcctcgtcctcagctgcctgcgcgcc
gaccacgagggcgtggcggccacctactacgccgacgcccgtgacatcagccgcgccctg
gacgccggcacgctggagacgttgcgctccccggtcttccggctcaacgcccccggctcc
tacgtccgggaggtggccggcggcaacgacgtgctctccgatccggtgccggtgatcagc
ggtcccgacgactccccggagatctccgtctccgccaacggcgtccgcgcgatgaccagc
ggcgggcaggcagcgctcgaccgcctccaggcggcctgccgggaagtggcccacgaggtc
ttcctccggcccggccaggccctgctcatcaacaaccgcaagggcctgcacgcccgctcg
cagttcaccgcccgctacgacggcgccgaccgctggctgcagcgcacctacgtccgccgc
aaccagtggagcatccgctaccgcgtgacccccgacaaccgccgggtccacttctga

DBGET integrated database retrieval system