KEGG   Sorangium cellulosum So0157-2: SCE1572_13710Help
Entry
SCE1572_13710     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00260  Glycine, serine and threonine metabolism
scu00330  Arginine and proline metabolism
scu00340  Histidine metabolism
scu00350  Tyrosine metabolism
scu00360  Phenylalanine metabolism
scu00380  Tryptophan metabolism
scu01100  Metabolic pathways
scu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCE1572_13710
   00330 Arginine and proline metabolism
    SCE1572_13710
   00340 Histidine metabolism
    SCE1572_13710
   00350 Tyrosine metabolism
    SCE1572_13710
   00360 Phenylalanine metabolism
    SCE1572_13710
   00380 Tryptophan metabolism
    SCE1572_13710
Enzymes [BR:scu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     SCE1572_13710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 Pyr_redox DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGP35492
UniProt: S4XQN6
Position
complement(3834065..3835138)
Genome map
AA seq 357 aa AA seqDB search
MLDTAIIGGGVCGLSLSRSLSAVGADYQLFEARDRLGGRVLSVPAGPTRVDLGPTWFWPV
TQPLMSRLVDELELASFAQHDDGPIMVLSHPNKTPERYRGDTGLHGGGLRLVGGMGSLVD
ALAGAVPRERVHLGHVLEAVELDDAKVLLRFARGDGGLTVEARRVVLALPPRLLAENVRF
TPELPAPLRQAMTATPTWMAAQAKAVLTYRQPSWREDGLSGNAFVTHGQAVFGEIFDASD
PLHGLSALGAFLALPAGARARFAAELPLLIDKQIAQVFGEHLSRVEQHYKDWATDRFTCS
ARDREERPEHIGSGHPLLRQPYARGQVFFGAAETASYAAGYLEGALDAARRIRRDLA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacggcgatcatcggtggtggagtgtgcggcctgtcgttgtcgcggagcctg
tccgcggtgggtgcggactaccagctcttcgaggctcgggatcggctcgggggtcgcgtg
ctctctgttcctgccggcccaacgcgggtggacctggggcccacctggttctggcccgtc
acccagccgctcatgagccgcctcgtcgacgagctcgaactcgcgtccttcgcgcagcac
gacgacggaccgatcatggtcttgtcgcatcccaacaagacaccagagcgttacaggggc
gacacgggcctgcacgggggcgggctaaggctcgtgggaggaatgggcagcctggtcgat
gcccttgcgggggcggtgccgcgagagcgcgtgcatctcggtcacgtgctcgaggcggtc
gagctcgacgacgccaaggtgctgctccgctttgcgcgcggcgacggcgggctcacggtg
gaagcccgtcgcgtcgtgctcgcgctccctccgcgcctgctcgccgagaacgtccggttc
acgccggagctgccggcgccgctgcggcaagccatgacggcgacgcccacctggatggcg
gcgcaagccaaggcggtgctcacctaccggcagccgagctggcgcgaagacgggttgtcc
ggcaacgccttcgtgacccacggtcaggcggtgttcggcgagatcttcgacgcgtcggat
ccgctccatgggctcagcgcgctgggcgcgtttctggccctcccggccggagcgcgcgcg
cggtttgcggccgagctccccctcctcatcgacaagcagatcgcgcaggtgttcggcgag
catctgtcgcgtgtggagcagcattacaaggactgggcgaccgaccggttcacctgtagc
gcccgcgaccgcgaggagcgccccgagcacatcgggtcagggcaccccctgttgcggcag
ccgtacgctcgcgggcaggtgttcttcggcgccgccgagacggccagctatgcggccggc
tacctcgaaggcgcgctcgacgccgcacgccgcattcggcgtgacctcgcctga

DBGET integrated database retrieval system