KEGG   Sorangium cellulosum So0157-2: SCE1572_27415Help
Entry
SCE1572_27415     CDS       T02718                                 

Definition
(GenBank) glycogen branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00500  Starch and sucrose metabolism
scu01100  Metabolic pathways
scu01110  Biosynthesis of secondary metabolites
Module
scu_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCE1572_27415
Enzymes [BR:scu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SCE1572_27415
Exosome [BR:scu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCE1572_27415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AGP32571
UniProt: S4XJ66
Position
complement(7837620..7839866)
Genome map
AA seq 748 aa AA seqDB search
MLEQREVDLIAAVEHPDPHHVLGAHEDEDDLVVRAFRPDATEVAVLPDDPSLPKQPMERI
HPAGLFEARFPGVSYPKDGRFLYRIELRYPDGNASVERDPYGMPPTLGDVDRHLLAEGRH
WELYRVLGAHVREVDGVSGTSFAVWAPNARRVSVVGDFNHWDGRRHPMRRMGEGFWELFI
PGVGDGALYKYEIKTPEGHITVKSDPLGQAMELRPATASRVTTSRYTFQDGEWMRARGQL
DARKKPIAIYEVHPGSWRRVREDGPPYEHGMRWMTYRELADHLVEYVAELGFTHIELMPI
MEHPFDGSWGYQVAGYYAPTSRYGDPDDFRYFVDRCHQRGIGVILDWTPAHFPKDAWALG
RFDGTALYEHLDPRLGEHREWNTYIFNYGRHEVRNFLVANALYWLDEFHVDGLRVDAVAS
MLYLDYAAQGGDWVPNRYGGRENIEAIDFIRELSNRVHERCPGAIVCAEESTAWPSVTHA
TYVGGLGFDFKWNMGWMHDTLDFFKHEPVHRAFHYHQLTFGLIYAFSEKFLLPLSHDEVV
HLKRSLLSKMPGDYWQMLANLRALYGYMWAHPGKKLLFMGGEIGQFAEWSEKTELDWGLL
SVPAHAGLKRLVTDINALYKKYPAMYELDDEHHGFRWIDCTDNLQTVISFIRYGDGAGDQ
MSPSDQHVVFIGNFTPVPRRPYRIGVPRRGAYLEVLNTDATEYGGSGVGNMGRVVVEDIP
CHGFPQSIELTLPPLAVLWLIPERDAQP
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgttggaacaacgagaagtcgatctcatcgcggctgtggagcacccggatccgcaccac
gtgctcggcgcgcacgaggacgaagacgacctggtggtccgcgcctttcgcccggacgcc
accgaggtcgcggtgctcccggacgacccctcgctcccgaagcagcccatggagcgcatc
caccccgcgggcctcttcgaggcgcgcttccccggcgtctcctacccgaaggacggccgc
ttcctctaccggatcgagctgcgctacccggacggcaacgcctcggtcgagcgcgatccg
tacggcatgccgcccacgctcggcgacgtcgaccgccacctcctcgcggaggggaggcac
tgggagctctaccgcgtcctcggcgcgcacgtgcgcgaggtggacggcgtctccgggacg
tcgttcgcggtctgggcgccgaacgcgcgccgcgtgagcgtcgtcggcgacttcaaccac
tgggacggccgccgccacccgatgcgccgcatgggcgagggcttctgggagctcttcatc
cccggcgtcggcgacggcgcgctctacaagtacgagatcaagaccccggaggggcacatc
accgtgaagagcgatccgctcggccaggcgatggagctccggccggcgaccgcctcgcgg
gtcacgacgagccgctacacgttccaggacggcgagtggatgcgggcgcgcggccagctc
gacgcgcgcaagaagccgatcgccatctacgaggtccaccccggctcgtggcggcgcgtg
cgcgaggacggcccgccgtacgagcacgggatgcgctggatgacctaccgcgagctcgcc
gaccacctcgtcgagtacgtggccgagctcggcttcacgcacatcgagctcatgccgatc
atggagcacccgttcgacggctcgtggggctaccaggtggcgggctactacgccccgacc
agccgctacggcgatcccgacgacttccgctacttcgtcgaccggtgccaccagaggggc
atcggcgtgatcctcgactggaccccggcgcacttcccgaaggacgcgtgggcgctcggc
cggttcgacggcacggcgctctacgagcacctcgacccgcgcctcggcgagcaccgcgag
tggaacacgtacatcttcaactacggccggcacgaggtgcggaacttcctcgtcgccaac
gccctttactggctcgacgagttccacgtcgatggcctgcgcgtcgacgcggtcgcgtcg
atgctctacctcgactacgccgcgcagggcggggactgggtgccgaaccggtacggcggc
cgcgagaacatcgaggcgatcgacttcatccgggagctgtcgaaccgggtgcacgagcgc
tgcccgggcgcgatcgtgtgcgcggaggagtccaccgcctggccgtcggtgacgcacgcg
acgtacgtcggcgggctcggcttcgacttcaagtggaacatggggtggatgcacgacacg
ctcgacttcttcaagcacgagccggtccaccgcgcgttccactaccaccagctcacgttc
gggctcatctacgccttctcggagaagttcctcctgccgctgagccacgacgaggtcgtc
cacctcaagcggtcgctgctctcgaagatgcccggcgactactggcagatgctcgcgaac
ctgcgcgcgctctacgggtacatgtgggcgcacccgggcaagaagctgctcttcatgggc
ggcgagatcggccagttcgccgagtggagcgagaagacggagctcgactggggcctgctc
tcggtgcctgcccacgccgggctcaagcggctcgtgaccgacatcaacgcgctctacaag
aagtatccggcgatgtacgagctcgacgacgagcaccacggcttccgctggatcgactgc
accgacaacctgcagaccgtgatctcgttcatccgctacggggacggcgcgggagaccag
atgtcgccctcggaccagcacgtcgtgttcatcggcaacttcacgccggtcccgcgccgc
ccgtaccgcatcggcgtcccgcgccgcggcgcctacctggaggtgctcaacaccgacgcc
accgagtacggcggcagcggcgtgggcaacatgggccgcgtcgtggtcgaggacatcccc
tgccacgggttcccgcagtcgatcgagctgacgctcccgccgctcgcggtgctctggctc
atccccgagcgcgacgcgcagccctga

DBGET integrated database retrieval system