KEGG   Sorangium cellulosum So0157-2: SCE1572_30305Help
Entry
SCE1572_30305     CDS       T02718                                 

Definition
(GenBank) type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
scu  Sorangium cellulosum So0157-2
Brite
KEGG Orthology (KO) [BR:scu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:scu02044]
    SCE1572_30305
Secretion system [BR:scu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SCE1572_30305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AGP32619
UniProt: S4XJB4
Position
complement(8611519..8613003)
Genome map
AA seq 494 aa AA seqDB search
MATETQAAGSAGVQTLEGGSLLDEILAETKMTPGDEGYEIAKRGVQAFISELVAPRREGE
KVDKAFVDALIAEIDVKLSRQIDEILHHPSFQKLESAWRGLKFVIDRCDFRENVKVEMLN
CSKEDLLADFEDAPEVPKSGLYKLVYSAEFGQFGGKPVGAIIANYEFGPGPQDIALLQKC
AAVAAMSHAPFIAAAGPQFFGLKDFIGLPNLKDLKALFEGPQYTKWNAFRETEDSRYVGL
VMPRFLLRLPFGANTVPVKAFNYEEDVVGKHDAYCWGNATYAFATRLADSFAKYRWCPNI
IGPQAGGAVENLPLHQYEAMGEIQTKIPTEIMLTERREFELSEEGFIGLTFRKDSDNACF
FSANSAQKPKFYGQSEEGRAAEMNYRLGTQLPYMFIMCRIAHYLKVLQREQIGTWKERAD
LERELNEWIGQYVADQDVVSAATRGRRPLRKARIIVTEVPGNAGWYKVDMQVRPHFKYMG
AFFTLSLVGKLDKE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggagacacaggccgcggggagcgcaggcgtccagaccctggagggagggtcg
ctgctcgacgagatcctcgccgagacgaagatgacgcccggcgacgaggggtacgagatc
gccaagcggggcgtgcaggccttcatctcggagctcgtcgccccgcggcgcgagggtgag
aaggtcgacaaggccttcgtcgacgcgctgatcgcggagatcgacgtcaagctctcgcgg
cagatcgacgagatcctccaccaccccagcttccagaagctcgagtccgcctggcgcggc
ctcaagttcgtcatcgaccgctgcgactttcgcgagaacgtcaaggtcgagatgctcaac
tgctccaaggaggacctcctcgccgatttcgaggacgcccccgaggtgccgaagagcggc
ctgtacaagctcgtctactcggcggagttcggccagttcggcggcaagccggtcggcgcg
atcatcgcgaactacgagttcggccccggcccccaggacatcgcgctgctccagaagtgc
gccgccgtcgcggcgatgtcgcacgcgccgttcatcgcggcggcgggcccgcagttcttc
ggcctcaaggacttcatcgggctgcccaacctgaaggacctgaaggcgctcttcgagggg
ccgcagtacacgaagtggaacgcgttccgcgagaccgaggactcgcgctacgtcggcctc
gtgatgccgcgcttcctgctccgcctgcccttcggcgccaacaccgtcccggtgaaggcg
ttcaactacgaagaggacgtggtcggcaagcacgacgcgtactgctggggcaacgcgacg
tacgccttcgccacgcggctcgccgacagcttcgccaagtaccgctggtgtcccaacatc
atcggcccgcaggcgggcggcgcggtggagaacctgccgctccaccagtacgaggcgatg
ggcgagatccagaccaagatcccgaccgagatcatgctcaccgagcggcgcgagttcgag
ctgtccgaggagggcttcatcgggctcacgttccgcaaggactcggacaacgcctgcttc
ttctcggcgaactcggcgcagaagcccaagttctacgggcagagcgaggagggcagggcg
gccgagatgaactaccggctcgggacgcagctgccgtacatgttcatcatgtgccgcatc
gcgcactacctgaaggtgctgcagcgcgagcagatcgggacgtggaaggagcgcgccgac
ctcgagagggagctgaacgagtggatcggccagtacgtcgccgatcaggacgtcgtctcc
gcggcgacccgcgggcgccggccgctccgcaaggcgaggatcatcgtgaccgaggtgccg
ggcaacgccggctggtacaaggtcgacatgcaggtgcgcccgcacttcaagtacatgggc
gcgttcttcacgctgagcctcgtcggcaagctcgacaaggagtga

DBGET integrated database retrieval system