KEGG   Sorangium cellulosum So0157-2: SCE1572_30310
Entry
SCE1572_30310     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
scu  Sorangium cellulosum So0157-2
Brite
KEGG Orthology (KO) [BR:scu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:scu02044]
    SCE1572_30310
Secretion system [BR:scu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SCE1572_30310
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AGP32620
UniProt: S4XLG1
Position
complement(8613007..8613498)
AA seq 163 aa
MKEGSVAPKERVNITYKPATGNAKEDVELPLKMLMLGDYTQRPDPRPLEDRKPINVDKDN
FQKVMSEQKLALTFNVKDVLSEQENSELTVNLKFRRLSDMEPEAIATQVPELKKLLDLRA
ALTALKGPLGNEKAFRNKIQQILSDPAQRNKIVSELGLDKEGE
NT seq 492 nt   +upstreamnt  +downstreamnt
atgaaagagggatcggtcgcgccgaaggagcgcgtgaacatcacgtacaagccggccacg
gggaacgcgaaggaggacgtcgagctgccgctgaagatgctgatgctcggcgactacacg
cagcggccggatccgcggcccctcgaggaccgcaagccgatcaacgtggacaaggacaac
ttccagaaggtcatgagcgagcagaagctcgcgctcaccttcaacgtcaaggacgtcctg
tccgagcaggagaacagcgagctcacggtcaacctcaagttccgccggctgagcgacatg
gagcccgaggccatcgcgacccaggtgccggagctcaagaagctcctcgacctgcgcgcc
gcgctgacggccctcaagggcccgctcgggaacgagaaggcgttccgcaacaagattcag
cagatcctgagcgacccggctcagcgcaacaagatcgtgagcgagctcgggctcgacaag
gaaggggagtga

DBGET integrated database retrieval system