KEGG   Sorangium cellulosum So0157-2: SCE1572_34370Help
Entry
SCE1572_34370     CDS       T02718                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00072  Synthesis and degradation of ketone bodies
scu00280  Valine, leucine and isoleucine degradation
scu00650  Butanoate metabolism
scu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCE1572_34370
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCE1572_34370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCE1572_34370
Enzymes [BR:scu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     SCE1572_34370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AGP32689
UniProt: S4XJH2
Position
9766392..9767057
Genome map
AA seq 221 aa AA seqDB search
MGLTREQIAQRAALELKDGYYVNLGIGMPTLVANYIPAGIEVVLQSENGLLGIGPYPAEG
AEDADLINAGKETVTMLPGSAIFSSAESFAQIRGGHIDLAILGAMEVSEKGDLANWMIPG
KMVKGMGGAMDLVVSAKRVVVIMDHAAKNGAPKILTECALPLTGRGVVHRIITDLAVLDV
TPEGLVLRELAPGVSAREVQEKTQPTLRVPSDVKEMGQRSA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggactcacgcgggaacagatcgcgcagcgcgccgcgctggagctcaaggacggctac
tacgtcaacctcggcatcgggatgccgacgctcgtcgccaactacatccccgcggggatc
gaggtggtgctccagagcgagaacgggctgctcggcatcggcccctaccccgccgagggc
gcggaggacgcggacctcatcaacgccggcaaggagacggtgaccatgctccccggctcg
gcgatcttctcgagcgccgagtcgttcgcgcagatccggggcggccacatcgacctcgcg
atcctcggggccatggaggtctccgagaagggcgatcttgccaactggatgatccccggc
aagatggtgaaggggatgggcggggcgatggatctcgtggtgagcgcgaagcgcgtcgtc
gtgatcatggatcacgcggcgaagaacggcgcgcccaagatcctgaccgagtgcgcgctg
cccctcaccgggcgcggcgtggtccaccggatcatcaccgatctcgccgtgctcgacgtg
acgcccgaggggctcgtgctgcgcgagctcgcgcccggcgtgagcgcccgagaggtgcag
gagaagacacaaccaacgctccgggtcccctccgacgtgaaggagatggggcagcggagc
gcctag

DBGET integrated database retrieval system