KEGG   Sorangium cellulosum So0157-2: SCE1572_39755Help
Entry
SCE1572_39755     CDS       T02718                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00520  Amino sugar and nucleotide sugar metabolism
scu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCE1572_39755
Enzymes [BR:scu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     SCE1572_39755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 adh_short NAD_binding_10 DUF3748
Motif
Other DBs
NCBI-ProteinID: AGP40103
UniProt: S4YBD6
Position
11221072..11222082
Genome map
AA seq 336 aa AA seqDB search
MSAALRILVTGGAGFVGSHLCDRLIRDGHEVIALDDFSTGARGNVAHLLLHRRFRLVEHD
VTQPYDLQVDRIYNLASPASPPHYQRDPVRTTLINVVGAFHALKLAEGCGARVFQASTSE
VYGDPEVHPQPEGYRGSVNPIGIRSCYDEGKRCAESLVMDFHRRRGVEVRMARIFNTYGP
RMALDDGRVVSNFIVQALKGEDLTVYGAGSQTRSFCYVDDLVEGIVRLMEHPTETGPVNL
GNPEEFTVLELAEEVIRLTGSRSRIAFRPLPQDDPRQRQPVIDHAKRVLGFEPKVPLRAG
LRRTIEGFRSVLGLGRHAPALAASEGDAALPQAANG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgcgctgcgcatcctggtgaccggaggcgccggcttcgtcggctcccacctg
tgtgatcggctgatccgcgacggccacgaggtcatcgcgctcgacgatttctcgaccggc
gcccggggcaacgtcgcccacctcctcctccatcgtcgcttccggcttgtggagcacgac
gtcacccagccgtacgatctccaggtcgaccgcatctacaacctcgcctcgccggcgagc
ccgccgcattaccagcgcgatccggtgcggaccacgctgatcaacgtggtcggcgcgttc
cacgcgctgaagctcgccgagggctgcggggcgcgggtgttccaggcgtcgacgagcgag
gtctacggcgatcccgaggtccacccgcagccggagggctaccggggctcggtgaacccg
atcgggatccgctcctgttacgacgaggggaagcgctgcgccgagtcgctggtgatggac
ttccaccgtcgccgcggcgtcgaggtccggatggcgcggatcttcaacacctacggtccg
cggatggcgctcgacgacgggcgcgtggtgtcgaacttcatcgtccaggcgctaaagggc
gaggatctgacggtctacggcgccggctcgcagacgcggagcttctgctacgtggacgat
ctcgtcgaggggatcgtgcggctgatggagcaccccaccgagacgggcccggtgaacctg
ggcaatccggaggagttcacggtgctggagctcgccgaggaggtgattcgcctgaccggg
agccggagccggatcgcgttccgcccgctgccgcaggacgatccgcggcagcggcagccg
gtcatcgatcatgcgaagcgggtgctcggcttcgagccgaaggtgccgctgcgggcgggg
ctgcgccggacgatcgagggtttccggagcgtgctcgggctgggccggcacgcccctgcg
ctggcggcgtcggagggcgacgcggcgctgcctcaggccgcgaacggctga

DBGET integrated database retrieval system