KEGG   Sorangium cellulosum So0157-2: SCE1572_41455Help
Entry
SCE1572_41455     CDS       T02718                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00071  Fatty acid degradation
scu00280  Valine, leucine and isoleucine degradation
scu00310  Lysine degradation
scu00362  Benzoate degradation
scu00380  Tryptophan metabolism
scu00620  Pyruvate metabolism
scu00630  Glyoxylate and dicarboxylate metabolism
scu00640  Propanoate metabolism
scu00650  Butanoate metabolism
scu00900  Terpenoid backbone biosynthesis
scu01100  Metabolic pathways
scu01110  Biosynthesis of secondary metabolites
scu01120  Microbial metabolism in diverse environments
scu01130  Biosynthesis of antibiotics
scu01200  Carbon metabolism
scu01212  Fatty acid metabolism
scu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCE1572_41455
   00630 Glyoxylate and dicarboxylate metabolism
    SCE1572_41455
   00640 Propanoate metabolism
    SCE1572_41455
   00650 Butanoate metabolism
    SCE1572_41455
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCE1572_41455
   00072 Synthesis and degradation of ketone bodies
    SCE1572_41455
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCE1572_41455
   00310 Lysine degradation
    SCE1572_41455
   00380 Tryptophan metabolism
    SCE1572_41455
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCE1572_41455
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCE1572_41455
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCE1572_41455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scu04147]
    SCE1572_41455
Enzymes [BR:scu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SCE1572_41455
Exosome [BR:scu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCE1572_41455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGP32810
UniProt: S4XM11
Position
11677483..11678667
Genome map
AA seq 394 aa AA seqDB search
MTLPVPVYIVAAARTPIGAFQGALSPLPAPRLGEVAIRAALERASLSPDAVGEVFLGNVL
SAGIGQAPARQAAIYAGIPSKVPATTVSKVCGSGLQAVIFGAKTVALGDADVVVAGGMES
MSNVPYYLPQARSGYRMGDGKLVDGMIHDGLWDPYGNFHMGTAGEACAKEHGFSREAQDE
YARESFRRALAAQREGLFAAEIAPVAVPQKKGDAVVVKDDEGPPAGKPEKFASLRPAFQK
DGTITAANASSINDGASALVLASERAVKEHKLTPLARIVGYGGAAQAPEWFTTAPAAAIA
NTTKKLGLTTDQIDLYEVNEAFAVVALAVNKLAGIDAQRVNVRGGAVALGHPIGASGARI
LTTLLYAMKDRGAKRGLATLCIGGGEALAVVVER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccctacccgtccccgtgtacatcgtcgcagcggcccggacgccgatcggcgcgttc
cagggagcgctctcgcccttgcccgccccccgcctgggcgaggtcgccatccgggcggcc
ctcgagcgggcgagcctctctcccgacgccgtgggggaggtcttcctgggcaatgtcctg
tccgccggcatcgggcaggctccggcccggcaggccgccatctatgccggcatcccgagc
aaggtcccggccaccacggtgagcaaggtgtgcggctcggggctccaggcggtcatcttc
ggcgcgaagacggtggcgctcggcgacgcggacgtggtggtcgccggcggcatggagtcg
atgtcgaacgtgccttactacctcccgcaggcgcgctccggctaccgcatgggcgacggc
aagctcgtggacgggatgatccacgacggcctctgggacccgtacggcaacttccacatg
ggcacggcgggcgaggcgtgcgccaaggagcacggcttctcgcgcgaggcgcaggacgag
tacgcgagggagagcttccgccgggcgctcgcggcgcagcgcgaggggctgttcgccgcg
gagatcgcgcccgtcgccgtcccgcagaagaagggcgacgcggtggtcgtgaaggacgac
gagggcccgccggccggcaagcccgagaagttcgcctcgctgaggcccgccttccagaag
gacggcacgatcaccgcggccaacgcctcgtcgatcaacgacggcgcgagcgcgctcgtc
ctggcgagcgagcgggccgtgaaggagcacaagctcacgccgctcgcgcggatcgtcggc
tacggcggcgccgcgcaggcgcccgagtggttcaccacggcgccggcggcggcgatcgcg
aacaccacgaagaagctcggcctgacgacggaccagatcgacctctacgaggtgaacgag
gcgttcgcggtggtggcgctcgccgtgaacaagctcgccgggatcgacgcccagcgggtc
aacgtccgcggcggcgcggtcgcgctcggccacccgatcggcgcgagcggggcgcgcatc
ctgacgacgctgctctacgccatgaaggaccggggcgcgaagcgcggcctcgccacgctg
tgcatcggcggcggcgaggcgctcgcggtcgtcgtggagcggtga

DBGET integrated database retrieval system