KEGG   Staphylococcus condimenti: A4G25_06140Help
Entry
A4G25_06140       CDS       T04648                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
scv  Staphylococcus condimenti
Brite
KEGG Orthology (KO) [BR:scv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A4G25_06140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMY05541
UniProt: A0A143PAH4
Position
complement(1214487..1215494)
Genome map
AA seq 335 aa AA seqDB search
MDYVLIITVAIVIFSLIFDFINGFHDTANAVATAVSTRALTPRRAIFLAAIMNFIGALTF
TGVAGTITKDIVDPFKLQNGLVVVLAAIFAAIFWNLLTWYFGIPSSSSHALIGAIAGAAV
ASQGSFTVLHFQGFTKIIIVLIVSPLIAFCVGYIMYTIIKIFFKNANLTKTNRNFRIFQI
FTAALQSFSHGTNDAQKSMGIITLALIVANLQDGNNVEPALWVKVACATAMGLGTAIGGW
KIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLSTTHVVSSSILGVGASNRAKG
VKWNTAQRIIVTWVITLPISAIVAAITYWIMHIFI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggactatgttttaataatcactgtagctatcgtcattttttcattgatatttgacttt
attaatggtttccatgatacagccaatgcggtagccactgcagtgtcaacaagagcgttg
acgccacgtcgcgcaatttttctcgcagccataatgaattttatcggtgcgcttacattc
acaggtgtagctggaacaattactaaagacatcgtagatccattcaaattacagaatggt
cttgttgttgtgctggcagcaatttttgccgctattttttggaacttattaacttggtac
ttcggtattccaagttcatcttcacatgctttaatcggtgcaatcgcaggggcagctgtt
gcttctcaaggttcatttacggtattgcacttccaaggctttactaaaattattatcgta
ttaatcgtttcaccattaattgcattctgtgttggttacattatgtataccattattaag
attttctttaagaatgcaaacttaacaaaaacaaatcgtaactttagaatattccagatt
ttcacagcagcgttacagtcattctcacatggtacaaatgatgctcaaaaatctatgggt
atcattacattagcgttaatcgttgctaatttgcaagacggtaataacgttgaaccagct
ttgtgggttaaagtagcttgtgcgactgcaatgggtctcggtactgcaattggtggttgg
aaaatcatcaaaacagtgggcggtaacattatgaaaatccgcccggccaatggtgctgca
gctgacttatcatcagctttaacaatttttgtagcgtcatcgttacatttcccattatct
acaacacacgttgtatcttcatcaatccttggtgtaggtgcttctaaccgcgctaaaggt
gttaaatggaatacagcgcaacgtataattgtaacatgggtgattacattgccgatttca
gctattgtagctgcgattacttattggataatgcatatttttatatag

DBGET integrated database retrieval system