KEGG   Staphylococcus condimenti: A4G25_08495Help
Entry
A4G25_08495       CDS       T04648                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
scv  Staphylococcus condimenti
Pathway
scv00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:scv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A4G25_08495
Enzymes [BR:scv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A4G25_08495
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A4G25_08495
    1.1.1.-  
     A4G25_08495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AMY05963
UniProt: A0A143PCE7
Position
complement(1719346..1720398)
Genome map
AA seq 350 aa AA seqDB search
MKAAVWYGQKDVRVEERESKPLKDNEVRVKVSWTGICGTDLHEYLEGPVFIATDEPDPLL
GQKAPVTLGHEFSGVVDEVGSAVTAYKKGDRVVVNPTVSKQEKEENIDLYDGYSFIGLGA
DGGFAHYTNAPEGNVYHLPDNVSAKEGALVEPTAVAVQAIKEGEVLFGDTVAVIGAGPIG
LLNIIAAKAAGASKIFAFDLSDERLEKAKEVGATYVVNSGEVNPVDFINEHTENGVDVTF
EVAGVAATLAQSIDITRPRGTVVIVSIFSHPVQFDPMQLTNTGVKLTSTIAYTPTTFQQT
IDLISEGNLNVKPVITDEIVLEDIVEAGFEKLVSDKSQAKILVELNGDQV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtttggtatggtcaaaaggatgtacgtgttgaggaacgtgaaagtaag
ccgttaaaagataatgaagtccgtgtgaaagtctcttggacaggaatttgcggaacagat
ctacatgaatatttagaagggcctgtttttattgcgacagatgaacccgatccgcttcta
ggacaaaaagctccagttacactaggtcatgaattctcaggtgttgtagacgaagtagga
agtgctgtaacagcttacaaaaaaggtgaccgtgtagtagtgaaccctacagtttctaaa
caagaaaaagaagaaaacattgacctttatgatggatattcatttatcggattaggtgca
gatggtggctttgcgcactatacaaatgcaccagaaggaaatgtataccatttacctgat
aacgtatccgcaaaagaaggcgcattagttgagccaactgcagtagcagttcaagcaatc
aaagaaggcgaagtactgtttggagatacagttgctgtaatcggtgctggtccaatcgga
ttgttaaatattattgccgcaaaagcagcaggggcaagtaaaatctttgcgtttgattta
tcagatgaacgtttagaaaaagcaaaagaagtaggagctacgtatgtagtgaattcagga
gaggtaaaccctgttgatttcattaatgagcacactgaaaatggtgtagatgtgacattt
gaagttgcaggtgtggctgcgactttagcacaatctattgatattacacgtcctcgcggt
actgtagtaattgtttctattttcagtcaccctgttcaattcgatccaatgcaattaaca
aatacaggtgtgaaactgacttctacaattgcatatacaccaacaacattccaacaaaca
attgatttaatcagtgaaggcaatttaaatgttaaacctgtaataacagatgaaatcgta
ttagaagatatcgttgaagctggattcgaaaaattagttagcgataaatctcaagcgaaa
atcttagttgaattaaacggtgatcaagtctaa

DBGET integrated database retrieval system