KEGG   Staphylococcus condimenti: A4G25_10715Help
Entry
A4G25_10715       CDS       T04648                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scv  Staphylococcus condimenti
Pathway
scv00071  Fatty acid degradation
scv00072  Synthesis and degradation of ketone bodies
scv00280  Valine, leucine and isoleucine degradation
scv00310  Lysine degradation
scv00362  Benzoate degradation
scv00380  Tryptophan metabolism
scv00620  Pyruvate metabolism
scv00630  Glyoxylate and dicarboxylate metabolism
scv00640  Propanoate metabolism
scv00650  Butanoate metabolism
scv00900  Terpenoid backbone biosynthesis
scv01100  Metabolic pathways
scv01110  Biosynthesis of secondary metabolites
scv01120  Microbial metabolism in diverse environments
scv01130  Biosynthesis of antibiotics
scv01200  Carbon metabolism
scv01212  Fatty acid metabolism
scv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4G25_10715
   00630 Glyoxylate and dicarboxylate metabolism
    A4G25_10715
   00640 Propanoate metabolism
    A4G25_10715
   00650 Butanoate metabolism
    A4G25_10715
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4G25_10715
   00072 Synthesis and degradation of ketone bodies
    A4G25_10715
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4G25_10715
   00310 Lysine degradation
    A4G25_10715
   00380 Tryptophan metabolism
    A4G25_10715
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A4G25_10715
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A4G25_10715
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A4G25_10715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scv04147]
    A4G25_10715
Enzymes [BR:scv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A4G25_10715
Exosome [BR:scv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A4G25_10715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AMY06373
UniProt: A0A143PDM2
Position
2263715..2264866
Genome map
AA seq 383 aa AA seqDB search
MSKIAIVSAKRTPVGKFRGKLRNYSAVQLGTIALEAAIDAIELPKDSIENVIFGNVLQAG
NGQNPARQILVNAGLPTATPGMTINEVCGSGLKAVILGKQLIQLGEAKVVAVGGVESMTN
APKLLIEGKEKPVPSFMHDGLTDAFENVPMGITAERIADQYEVTREQQDEFAVKSHQKAY
EATNAGKYNEEMIPLKDADGEMMTADEGIRGNSNVEKLSTLDTIFKEDGSVTAGNASSIN
DGASALILMDEDYAKEHGFEVLATLGDYAEVGCDPEIMGIAPFYAVSKLLEKTGKTMNDI
DLVEMTEAFAVQSIAVKDNLNIPDEKLNIYGGAVAIGHPIGASGARLVTSLVNELHQENK
QNGIATACIGGGLGIALAVEKGE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattgcaattgtcagtgctaaacgtacaccagtaggtaaattcagaggtaaa
ctaagaaattattctgcagttcaacttggtacaatcgctttagaagcagctatcgatgca
atcgaattgccgaaagattcaattgaaaatgttattttcggtaatgtattacaagctggg
aatggacaaaatccagcacgtcaaatattagtcaatgcaggtttaccaactgcaactcct
ggtatgactattaatgaagtatgtggttctggtctgaaagcagtcattttaggtaaacaa
ctgattcaattaggcgaagcaaaagttgtagcagtaggcggtgttgagagtatgactaat
gcacctaaattgcttatcgaaggtaaagaaaaacctgtgcctagctttatgcatgatggt
ttgacagatgcctttgaaaatgtgcctatgggtattacagcagaacgtattgctgatcaa
tatgaagtgactcgtgaacaacaagatgaatttgctgttaaatcacatcaaaaagcatac
gaagcgacaaatgccggtaaatataatgaagaaatgattccgctaaaagatgcagatgga
gaaatgatgacagcagatgaaggtattcgaggcaacagtaatgtagaaaaattatctact
ttagatactatttttaaagaagatggttctgtaactgcgggtaacgcttcaagtattaat
gatggtgcgtcagcattaattttaatggacgaagattatgcaaaagaacatggttttgaa
gtgttagccactcttggcgattatgcagaagtaggttgtgatcctgaaattatgggtatt
gcaccgttttatgctgtaagcaagttactagaaaaaacaggcaaaacaatgaatgatatc
gatttagtagaaatgacagaagcatttgctgtacaaagtattgcggttaaagataacttg
aacattcctgatgaaaaactaaatatttatggcggagcagttgcaattggtcatcctatc
ggtgccagcggtgctcgtttagtaacatcgttagtaaacgaacttcatcaagaaaataaa
caaaacggtatcgcaacagcttgtatcggcggaggcttaggtatcgcattagcagttgaa
aaaggagaataa

DBGET integrated database retrieval system