KEGG   Streptomyces cyaneogriseus: TU94_07825Help
Entry
TU94_07825        CDS       T03687                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
scw  Streptomyces cyaneogriseus
Brite
KEGG Orthology (KO) [BR:scw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TU94_07825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2070
Motif
Other DBs
NCBI-ProteinID: AJP01405
UniProt: A0A0C5FYC0
Position
1963849..1965108
Genome map
AA seq 419 aa AA seqDB search
MESFSLILAIVVVTALAFDFTNGFHDTANAMATTISTGALRPKVAVAMSAVLNLVGAFLS
VEVANTISKGLVDETGIRPEVIFAALVGAILWNLLTWLVGLPSSSSHALMGGLIGAAIAS
AGVGAVHGDVLVTKVLLPAVAAPIVAGVAAMFASRLTYTLGRKADGEAAKKGYRAGQIAS
AGLVSLAHGTNDAQKTMGIITLALVAGGALTPDSDPPMWVILSAGLAIALGTYLGGWRII
RTMGKGLTDLQPQQGFAAQTSAATVILASSHLGFSLSTTHSVSGAVMGAGLGRKGGVVRW
STATRMFVAWGLTLPAAALVAALAEWVCGLGDWGTALVAVFLVASSFAIWKISRREVVDH
TNVNDTDEAGDAEPAGVVTTAIAAVTPPPAGAAAEGLTATIPAQATASDAKAPSAATPV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcttctcgctgatcctcgcgattgtggtggtgaccgcactcgcgttcgatttc
acgaacggtttccacgacaccgcgaacgcgatggccacgaccatttccacgggcgctctg
cggcccaaggtcgcggtggccatgtccgccgtcctcaatctggtgggcgccttcctctcc
gtggaggtcgccaacaccatctccaagggtctcgtcgacgagaccggcatccggcccgag
gtcatattcgccgccctggtcggcgcgatcctctggaacctgctgacctggctggtcggc
ctgccgtccagctcctcgcacgccctgatgggcggtctgatcggcgccgcgatcgcttcc
gcgggcgtcggcgcggtccacggcgacgtgctcgtcaccaaggtgctgctgccggcggtc
gccgccccgatcgtcgcgggcgtcgcggcgatgttcgcctcccggctgacgtacacgctg
ggccgcaaggccgacggcgaggccgccaagaagggctaccgcgccgggcagatcgcctcg
gccggcctggtctcgctggcgcacggcaccaacgacgcgcagaagacgatgggcatcatc
accctcgccctggtcgccggcggcgccctcacccccgactccgaccccccgatgtgggtc
atcctctccgcgggcctggccatcgcgctcggcacctacctcggcggctggcgcatcatc
cgcaccatgggcaagggcctgaccgacctccagccgcagcagggcttcgccgcccagacc
agcgccgccacggtcatcctggcctcctcccacctcggcttctccctctccaccacgcac
tcggtctccggtgccgtgatgggcgcgggcctcggccgcaagggcggtgtggtgcgctgg
tccacggccacccggatgttcgtcgcctggggtctgaccctgcccgccgcggccctggtc
gccgcgctcgccgagtgggtctgcggcctgggcgactggggcacggcgctggtcgcggtc
ttcctggtcgcctccagcttcgccatctggaagatctcccgccgcgaggtcgtcgaccac
accaacgtcaacgacaccgacgaggccggggacgccgagccggccggggtggtcaccacc
gcgatcgccgccgtgaccccgcccccggcgggcgcggccgccgaggggctgaccgccacc
atcccggcccaggccaccgcctccgacgccaaggcgccgtcggccgccacccccgtctga

DBGET integrated database retrieval system