KEGG   Streptomyces cyaneogriseus: TU94_11470Help
Entry
TU94_11470        CDS       T03687                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K22322  A-factor type gamma-butyrolactone 1'-reductase (1S-forming) [EC:1.1.1.413]
Organism
scw  Streptomyces cyaneogriseus
Brite
KEGG Orthology (KO) [BR:scw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TU94_11470
Enzymes [BR:scw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.413  A-factor type gamma-butyrolactone 1'-reductase (1S-forming)
     TU94_11470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase ADH_zinc_N Polysacc_synt_2 3HCDH_N Fox-1_C
Motif
Other DBs
NCBI-ProteinID: AJP05630
UniProt: A0A0C5G9T2
Position
2799993..2800724
Genome map
AA seq 243 aa AA seqDB search
MITGASSGIGAAAARLFAAQGAAVVLMARREERLRALAAELTASGARALAVPGDVASEAD
AAHAVKVAVTEFGGLDCAFNNAGYATAGTPLHETDAAVYERTMDVNVRGVWNCMRHQIPA
MVSRGGGSIVNTSSVAGTRATGASAAYVAAKHAVIGLTRAAAAEYGERGVRVNALVVGST
RTEMMEQVLRTAPELEDRFAADAIQKRMAAPVEVARAAAWLCGDGSSFVTGAAVPVDGGA
TAT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccggtgcctccagcggtatcggtgcggccgcggcccggctgttcgccgcgcag
ggcgcggcggtcgtcctgatggcccggcgcgaggagcggctgcgcgccctggccgccgag
ctcaccgcgtccggcgcccgggccctggccgtccccggcgacgtcgcctcggaggccgac
gcggcgcacgccgtcaaggtcgccgtcaccgagttcggcgggctcgactgcgccttcaac
aacgccggttacgcgacggcgggcacccccctgcacgagaccgacgccgccgtctacgag
cgcaccatggacgtcaacgtgcgcggcgtgtggaactgcatgcggcatcagatccccgcg
atggtgagccggggcggcggctccatcgtgaacacctccagcgtggccgggacacgggcc
accggcgcctcggccgcctacgtcgccgccaagcacgcggtcatcgggctgacccgggcc
gccgcggccgagtacggggagcggggcgtgcgggtcaacgccctggtcgtgggcagcacc
cgcacggagatgatggagcaggtgctgcggacggctccggagctggaggaccgtttcgcg
gcggacgcgatccagaagcggatggccgcgcccgtcgaggtggcgcgggccgcggcctgg
ctgtgcggcgacgggtcgtcgttcgtgaccggcgcggcggtgccggtggacgggggcgcg
acggccacctga

DBGET integrated database retrieval system