KEGG   Streptomyces cyaneogriseus: TU94_21440Help
Entry
TU94_21440        CDS       T03687                                 

Definition
(GenBank) phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
scw  Streptomyces cyaneogriseus
Brite
KEGG Orthology (KO) [BR:scw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TU94_21440
Enzymes [BR:scw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     TU94_21440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP Glyco_hydro_114
Motif
Other DBs
NCBI-ProteinID: AJP03665
UniProt: A0A0C5G4W8
Position
5028392..5029249
Genome map
AA seq 285 aa AA seqDB search
MRIDLHTHSTASDGTDTPAELVRNAAAAGLDVVALTDHDTTRGHAEAIAALPEGLTLVTG
AELSCRLDGVGIHMLAYLFDPEEPALLAERELVRDDRVPRAKGMVAKLNELGVPVTWEQV
ARIAGDGSVGRPHVASALVELGVVPTVSDAFTAQWLADGGRAFVEKHETDPFEALRLIKG
AGGVAVFAHPGAAKRGRTVSEAAIAEMAAAGLDGIEVDHMDHDADTRARLRGLAKELGLL
VTGSSDYHGSRKSCGLGEYTTDPEVYGEITRRAFGAFPVPGAGGA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgatctgcacacccactccaccgcgtcggacggtacggacaccccggccgag
ctggtgcgcaacgcggccgcggccggcctggacgtcgtcgcgctgaccgaccacgacacc
acccgcggacacgccgaggcgatcgccgcgctgcccgaggggctgacgctggtcacgggg
gccgagctctcctgccgtctcgacggcgtcggcatacacatgctggcctacctcttcgac
cccgaggagccggcgctgctcgccgagcgggaactggtccgggacgaccgggtgccgcgc
gccaagggcatggtcgccaagctcaacgagctgggcgtgcccgtcacctgggagcaggtc
gcgcgcatcgccggcgacggctcggtcggccgtccgcacgtcgcctccgccctggtcgag
ctgggcgtggtgcccaccgtgagcgacgccttcaccgcgcagtggctggcggacgggggg
cgggccttcgtggagaagcacgagaccgaccccttcgaggcgctccggctgatcaagggc
gccggcggggtcgcggtcttcgcgcacccgggcgccgccaagcgcggccgtacggtgtcc
gaggccgcgatcgcggagatggccgccgccgggctcgacggcatcgaggtcgaccacatg
gaccacgacgccgacacccgggcgcggctgcgcgggctggccaaggaactggggctcctg
gtgaccggctccagcgactaccacggcagccgcaagagctgcgggctcggcgagtacacc
acggaccccgaggtgtacggggagatcacgcgacgggcgttcggggcgttcccggtgccg
ggggccggcggggcctga

DBGET integrated database retrieval system