KEGG   Streptomyces cyaneogriseus: TU94_25165Help
Entry
TU94_25165        CDS       T03687                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00072  Synthesis and degradation of ketone bodies
scw00280  Valine, leucine and isoleucine degradation
scw00650  Butanoate metabolism
scw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TU94_25165
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    TU94_25165
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TU94_25165
Enzymes [BR:scw01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     TU94_25165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AJP04263
UniProt: A0A0C5G2Q0
Position
complement(5979554..5980309)
Genome map
AA seq 251 aa AA seqDB search
MNKVRPSAAEAVADIPDGASLAVGGFGLSGVPDVLIRALHDQGAAGLEVVSNNCGVDGRG
LGVLLAAGRIARVTGSYVGENKEFARQYLSGELEVELTPQGTLAERLRAGGAGIPAFYTP
AGVGTQVARGGLPWRYAADGSVAVASPPKETRDFAGRPHVLEQGITTDYALVRAWRGDRH
GNLVFRRAAANFNPLAAMAGRITIAEVEELVEPGGLRPDEVHLPGIHVQRVVGLSPAEAA
DKRIEKRTVRS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaggtccgccccagcgcggccgaagcggtcgccgacatccccgacggcgcctcg
ctcgccgtcggcggcttcggcctcagcggcgtacccgacgtcctcatccgcgccctgcac
gaccagggcgcggccggcctggaggtcgtctccaacaactgcggcgtggacggccggggc
ctgggcgtcctgctggccgccgggcgcatcgcccgcgtgaccggctcctacgtcggggag
aacaaggagttcgcccgccagtacctctccggggaactggaggtggagctgaccccgcag
ggcaccctcgccgaacggctgcgggcgggcggcgcgggcatccccgccttctacaccccg
gccggcgtgggcacccaggtcgcgcggggcggcctgccctggcggtacgcggccgacggc
tcggtcgccgtcgcctccccgcccaaggagacccgcgacttcgcgggccgcccgcacgtc
ctggagcagggcatcaccaccgactacgccctggtgagggcctggcgcggcgaccgccac
gggaacctggtgttccgccgcgccgccgccaacttcaacccgctggccgccatggccggc
cggatcaccatcgccgaggtggaggaactggtggagccgggcggcctgcgccccgacgag
gtgcacctgcccggcatccacgtgcagcgcgtcgtggggctctccccggccgaggccgcc
gacaagcggatcgagaagaggacggtgcgttcctga

DBGET integrated database retrieval system