KEGG   Streptomyces cyaneogriseus: TU94_27800Help
Entry
TU94_27800        CDS       T03687                                 

Definition
(GenBank) cellulose 1,4-beta-cellobiosidase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00500  Starch and sucrose metabolism
scw01100  Metabolic pathways
scw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TU94_27800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TU94_27800
Enzymes [BR:scw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     TU94_27800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2
Motif
Other DBs
NCBI-ProteinID: AJP04699
UniProt: A0A0C5G8N4
Position
6616506..6618230
Genome map
AA seq 574 aa AA seqDB search
MNRTRTALLAALTLVAGASGTAFAALPGDSAVAAIPCTVDYKVQNQWSTGFTAAVTVTNN
GAAKSAWQVKWSYAGNQKVTSAWNAKVTQSGTAVTAANEGYNGQLATGGSVSFGFQGSYS
GTNAIPATFTLDGVTCNVDDGGSGGPGGPTDPPPNPSGKADNPYAGAKGYVNPEWSAKAA
AEPGGTRVSNQPTGVWLDRIAAINGVNGGMGLRDHLDEALKQKGSGELYIQLVIYNLPGR
DCAALASNGELGPTEIDRYKKEYIDPIAAILADPKYAGLRIVTTIEIDSLPNLVTNVTPR
ATATPNCDVMKANGNYQKGVGYALNKLGDIANVYNYIDAGHHGWLGWDDNFGPSADMFKT
AATTEGATVADVHGFIVNTANYSALKENNFKITDTVNGTSVRQSKWVDWNRYTDELSYAQ
AMRDKLVSIGFDSKIGMLIDTSRNGWGGTQRPTGPGATTSVDTYVDGGRYDRRIHLGNWC
NQAGAGLGERPRANPEPGIDAYVWMKPPGESDGASKEIPNNEGKGFDRMCDPTYTGNPRN
NNNMSGALPDAPISGQWFSAQFRQLMQNAYPPLS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaaccagaacagcgttgctcgctgccctgacgctcgtcgccggagcctccggc
acggcgttcgccgcccttccgggcgactcggcggtggcagccatcccctgcacggtcgac
tacaaggtgcagaaccagtggagcaccggcttcaccgccgccgtcaccgtgaccaacaac
ggggccgccaagtccgcttggcaggtcaagtggtcgtacgccgggaaccagaaggtcacc
agcgcctggaacgccaaggtcacccagagcgggaccgccgtcaccgccgccaacgagggc
tacaacggccagctcgccaccggcggttcggtcagcttcggcttccagggcagctacagc
ggcaccaacgcgatccccgccaccttcaccctcgacggcgtcacctgtaacgtcgacgac
ggcggcagcggaggacccggcggacccaccgacccgccgcccaacccgtccggcaaggcc
gacaacccgtacgccggcgccaaggggtacgtgaaccccgagtggtccgcgaaggccgcc
gccgagccgggcggcacccgggtcagcaaccagccgaccggtgtctggctcgaccggatc
gccgccatcaacggcgtcaacggcggcatgggcctgcgcgaccacctcgacgaggcgctg
aagcagaagggctccggcgagctctacatccagctggtcatctacaacctgcccggccgt
gactgcgcggccctcgcctccaacggcgaactgggcccgacggagatcgaccggtacaag
aaggagtacatcgacccgatcgccgcgatcctcgccgacccgaagtacgcgggcctgcgg
atcgtcaccacgatcgagatcgactccctgcccaacctcgtcaccaacgtcacgccccgg
gccaccgccacgcccaactgcgacgtgatgaaggcgaacggcaactaccagaagggcgtc
ggctacgccctgaacaagctgggcgacatcgccaacgtctacaactacatcgacgccggc
caccacggctggctcggctgggacgacaacttcggcccctccgccgacatgttcaagacg
gccgccaccaccgagggcgccaccgtcgccgacgtccacggcttcatcgtcaacaccgcc
aactacagcgccctcaaggagaacaacttcaagatcacggacaccgtgaacggtacgtcc
gtgcgccagtccaagtgggtggactggaaccgctacaccgacgagctgtcctacgcccag
gccatgcgcgacaagctggtctcgatcggcttcgactcgaagatcggcatgctgatcgac
acctcccgcaacggctggggcggcacccagcggcccaccggccccggcgccacgaccagc
gtcgacacctacgtcgacggcggccgctacgaccgccgcatccacctcggcaactggtgc
aaccaggccggagcgggtctcggcgaacggccgcgggccaaccccgagccgggcatcgac
gcctacgtgtggatgaagccgccgggggagtcggacggcgcgagcaaggagatcccgaac
aacgagggcaagggcttcgaccggatgtgcgacccgacgtacaccggcaacccgcggaac
aacaacaacatgtccggtgccctcccggacgccccgatctccgggcagtggttctccgcg
cagttccggcagctgatgcagaacgcctacccgccgctgtcgtaa

DBGET integrated database retrieval system