KEGG   Streptomyces cyaneogriseus: TU94_29890Help
Entry
TU94_29890        CDS       T03687                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
scw  Streptomyces cyaneogriseus
Pathway
scw00020  Citrate cycle (TCA cycle)
scw00480  Glutathione metabolism
scw01100  Metabolic pathways
scw01110  Biosynthesis of secondary metabolites
scw01120  Microbial metabolism in diverse environments
scw01130  Biosynthesis of antibiotics
scw01200  Carbon metabolism
scw01210  2-Oxocarboxylic acid metabolism
scw01230  Biosynthesis of amino acids
Module
scw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:scw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TU94_29890
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TU94_29890
Enzymes [BR:scw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     TU94_29890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AJP05022
UniProt: A0A0C5FYC4
Position
complement(7108963..7111182)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASQAGVAVETRDISLAGRIIAVFPEYLTEDQ
RIPDALAELGELAKTPAANIIKLPNISASIPQLKAAIAELQGQGYALPDYPDDPKTDEER
EIRARYDKIKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTSESKTNVATMGEND
FRSTEKSVIIAEDGTLRIELVGDDGSTTVLRESVPVQKGEVVDASVMRVAALREFLAAQV
ARAKQEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAKYGATLAAAGLTPNDGLGGI
YKGLEALPEGAEIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIIDASMPAMIRTSGH
MWGPDGQEHDALAVIPDSSYAGVYQAVIDDCRVNGAYDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIAVTGTVRLVDQNGDAVIEQPVSAGDIFRACQTKDAPIKDWVKLAVTRARATGD
PAVFWLDATRAHDANLIKKVEQYLPEHDTEGLDIKILSPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSLEQYAEATGNARAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELARQTDDADLAKAFAPLAETLAANEQKIVEELNAVQGKPVDIGGYYQPDPAK
AAEVMRPSATWNEALASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacacacactgacgaggccccggccctggcgacgtat
tccttcctgccggtggtccaggcgtacgcctcgcaggcgggcgtcgcggtggagacccgc
gacatctcgctggccggacgcatcatcgccgtgttcccggagtacctcaccgaggaccag
cgcatcccggacgccctcgcggagctgggcgagctcgccaagacgccggccgccaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctcaaggcggccatcgccgagctc
cagggccagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgc
gagatccgcgcccgctacgacaagatcaagggctccgcggtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgccccggcgtcggtgaagaactacgccaagacccacccgcac
cgcatgggcgcctggacctccgagtccaagaccaacgtggcgaccatgggtgagaacgac
ttccgctccaccgagaagtccgtgatcatcgccgaggacggcacgctgcggatcgagctg
gtcggcgacgacggctccaccacggtcctgcgcgagtcggtgccggtccagaagggcgag
gtcgtcgacgcctccgtgatgcgggtcgccgcgctgcgcgagttcctcgccgcgcaggtc
gcgcgcgccaagcaggagggcgtgctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggtcacgtggtgcgcgccttcttcccgaagacgttcgcg
aagtacggtgcgacgcttgccgcggccggcctcaccccgaacgacggcctcggcggcatc
tacaagggcctggaggcccttcccgagggcgccgagatcaaggcgtccttcgacgccgag
ctggccgagggcccggagctggcgatggtcgactccgacaagggcatcaccaacttgcac
gtgccctcggacgtcatcatcgacgcctcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggccaggagcacgacgccctcgccgtcatcccggactcctcctac
gcgggcgtgtaccaggccgtcatcgacgactgccgcgtcaacggcgcctacgacccggcc
accatgggctcggtgcccaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcgcggtcacgggcacggtccgcctggtcgaccagaacggc
gacgccgtcatcgagcagcccgtctccgccggcgacatcttccgcgcctgccagaccaag
gacgccccgatcaaggactgggtgaagctggccgtcacccgggcccgcgccaccggcgac
ccggcggtgttctggctggacgccacccgcgcccacgacgccaacctgatcaagaaggtc
gagcagtacctgccggagcacgacaccgagggcctggacatcaagatcctgtccccggtg
gaggcgaccaagctgtcggtggagcgcatccgccgcggtgagaacaccatctcggtcacc
ggcaacgtcctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtggtcccgctgatggcgggcggcggcctgttcgagacgggcgcc
ggcggctccgcgcccaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
tcgctcggcgagttcttcgcgctggtgccgtcgctggagcagtacgccgaggccacgggc
aacgcccgcgccaaggtcctcgccgacaccctcgaccgtgccacggcgaccttcctcaac
gaggacaagtccccgacccggcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggcgcggcagaccgacgacgccgacctggccaag
gcgttcgcgccgctcgccgagaccctcgccgccaacgagcagaagatcgtcgaggagctg
aacgccgtccagggcaagccggtcgacatcggcggctactaccagcccgacccggccaag
gccgccgaggtcatgcgcccctcggccacctggaacgaggcgctggcgtccctgagctga

DBGET integrated database retrieval system