KEGG   Streptomyces sp. CdTB01: AS200_15670Help
Entry
AS200_15670       CDS       T04240                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00860  Porphyrin and chlorophyll metabolism
scx00970  Aminoacyl-tRNA biosynthesis
scx01100  Metabolic pathways
scx01110  Biosynthesis of secondary metabolites
scx01120  Microbial metabolism in diverse environments
Module
scx_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:scx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AS200_15670
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AS200_15670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scx01007]
    AS200_15670
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:scx03016]
    AS200_15670
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:scx02048]
    AS200_15670
Enzymes [BR:scx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     AS200_15670
Amino acid related enzymes [BR:scx01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   AS200_15670
Transfer RNA biogenesis [BR:scx03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AS200_15670
 Prokaryotic Type
   Other AARSs
    AS200_15670
Prokaryotic defense system [BR:scx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    AS200_15670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c Cellulase-like
Motif
Other DBs
NCBI-ProteinID: ALV33305
UniProt: A0A0U3QLB1
Position
complement(3549969..3551387)
Genome map
AA seq 472 aa AA seqDB search
MGLVRTALFNWAFARHHQGTLVFRIEDTDAARDSEESYQQLLEAMRWLGFDWDEGPEIGG
PHAPYRQSQRMDIYRDVAQKLLDAGHAYHCYCSQEELDTRREAARAAGKPSGYDGHCRAL
TEAQVEEYKAQGRAPIVRFRMPDETITFTDLVRGELTFTPENVPDYGIVRANGAPLYTLV
NPVDDALMEITHVLRGEDLLSSTPRQVALYKALTELGIAKQTPHFGHLPYVMGEGNKKLS
KRDPQSSLNLYRERGFLPEGLLNYLSLLGWSLSADQDIFSIEEMVAAFDIADVNPNPARF
DLKKCEAINADHIRLLDVKDFTERCAPWLKAPFAPWAPEDFDEAKWQAVAPHAQTRVKVL
SEITDNVDFLFLPEPVFDEASWAKAMKEGSDALLRTAREKLEAADWASAESLKEAVLAAG
EAHGLKLGKAQAPVRVAVTGRTVGLPLFESLEILGKERTLARIDAALAKLTA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgggcctggtccgcaccgccctgttcaactgggccttcgcccggcaccaccagggcacc
ctggtcttccgcatcgaggacaccgacgcggcccgcgactccgaggagtcctaccagcag
ctcctcgaggcgatgcgctggctgggcttcgactgggacgagggccccgagatcggcggc
ccgcacgcgccgtaccgccagtcgcagcgcatggacatctaccgcgacgtcgcgcagaag
ctcctggacgccggccacgcctaccactgctactgctcccaggaggagctggacacccgc
cgcgaggccgcccgcgccgccggcaagccgtccggctacgacggccactgccgcgccctc
accgaggcgcaggtcgaggagtacaaggcccagggccgcgccccgatcgtccgcttccgg
atgccagacgagacgatcaccttcacggacctggtccgcggcgagctgacgttcaccccg
gagaacgtcccggactacggcatcgtccgcgccaacggcgccccgctgtacacgctggtc
aacccggtcgacgacgccctgatggagatcacccacgtcctgcgcggcgaggacctgctc
tcctccaccccccgccaggtcgccctgtacaaggcgctgaccgagctgggcatcgccaag
cagaccccgcacttcggccacctgccctatgtcatgggcgagggcaacaagaagctgtcg
aagcgggatccgcagtcgtcgctgaacctctaccgcgagcgcggcttcctgcccgagggc
ctgctcaactacctctcgctgctcggctggtcgctctcggcggaccaggacatcttctcc
atcgaggagatggtcgcggccttcgacatcgccgacgtcaaccccaacccggcgcgcttc
gacctgaagaagtgcgaggcgatcaacgccgaccacatccgcctgctcgacgtgaaggac
ttcaccgagcgctgcgccccctggctgaaggcccccttcgccccctgggcgccggaggac
ttcgacgaggccaagtggcaggccgtcgccccgcacgcgcagacccgtgtgaaggtcctg
tcggagatcacggacaacgtcgacttcctgttcctgccggagccggtcttcgacgaggcg
tcctgggccaaggccatgaaggagggcagcgacgcgctgctgcgcacggcccgcgagaag
ctggaggcggccgactgggcctccgcggagtccctgaaggaggccgtcctggccgccggt
gaggcccacggcctcaagctcggcaaggcccaggccccggtccgcgtcgccgtcaccggc
cgcacggtcggcctgcccctcttcgagtccctggagatcctgggcaaggagcgcacgctg
gcccggatcgacgcggcactggcgaagctcacggcgtag

DBGET integrated database retrieval system