KEGG   Streptomyces sp. CdTB01: AS200_40570Help
Entry
AS200_40570       CDS       T04240                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00010  Glycolysis / Gluconeogenesis
scx00053  Ascorbate and aldarate metabolism
scx00071  Fatty acid degradation
scx00280  Valine, leucine and isoleucine degradation
scx00310  Lysine degradation
scx00330  Arginine and proline metabolism
scx00340  Histidine metabolism
scx00380  Tryptophan metabolism
scx00410  beta-Alanine metabolism
scx00561  Glycerolipid metabolism
scx00620  Pyruvate metabolism
scx00625  Chloroalkane and chloroalkene degradation
scx00903  Limonene and pinene degradation
scx01100  Metabolic pathways
scx01110  Biosynthesis of secondary metabolites
scx01120  Microbial metabolism in diverse environments
scx01130  Biosynthesis of antibiotics
Module
scx_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:scx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS200_40570
   00053 Ascorbate and aldarate metabolism
    AS200_40570
   00620 Pyruvate metabolism
    AS200_40570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AS200_40570
   00561 Glycerolipid metabolism
    AS200_40570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AS200_40570
   00310 Lysine degradation
    AS200_40570
   00330 Arginine and proline metabolism
    AS200_40570
   00340 Histidine metabolism
    AS200_40570
   00380 Tryptophan metabolism
    AS200_40570
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS200_40570
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AS200_40570
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AS200_40570
Enzymes [BR:scx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AS200_40570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALV37676
UniProt: A0A0U3QCQ4
Position
9089465..9090796
Genome map
AA seq 443 aa AA seqDB search
MNQPTPEQPADLVARLRATFRTGRTKPVEWRTAQLRRLRDMLTENGPDLAAALHADLGKS
AAEADRTEIGFTVREIDHTLDHLADWLRPEPAPVPAHLGDDTSAWTQYDPLGVVLVIAPW
NYPAQLLLAPLVGALAAGNAVVVKPSELAPATSAALARLLPEYLDTDAVAVVEGGIPETT
ALLAERFDHIFYTGNGTVGRVVMRAAAEHLTPVTLELGGKSPAFVDRGTDLDVVADRLAR
GKFLNAGQTCVAPDYVLTDPETAAALEPALTRAVEALYGTDPAASGAYGRIVNERHFDRL
TGLLDSGRTVVGGVADRAAKYIAPTVLADVDPDAPVMREEIFGPILPIVTVPGLDEAVDF
INDRDKPLALYVFSESGETRARIAAETSSGGLGHGLPLAHLTVSDLPFGGVGESGMGSYH
GRYSIETFSHRKAVLEKPLSPAR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcccacccccgagcagcccgccgacctcgtcgcccggctgcgcgccaccttc
cgcaccggccgcaccaagcccgtcgaatggcgcaccgcccagctgcgccgtctgcgcgac
atgctcaccgagaacggtcccgacctggccgccgccctccacgccgacctcggcaaaagc
gccgccgaggccgaccgcaccgagatcggcttcacggtccgcgagatcgaccacaccctc
gaccacctcgccgactggctgcgcccggagccggccccggtcccggcccacctcggcgac
gacacgagcgcgtggacgcagtacgacccgctcggtgtcgtcctggtcatcgccccctgg
aactaccccgcccagctcctgctggccccgctggtcggcgcgctcgcggcgggcaacgcg
gtggtcgtcaagcccagcgaactggcccccgccacctccgccgccctggcccgtctgctg
cccgagtacctcgacaccgacgcggtcgccgtcgtcgagggcggcatccccgagaccacg
gctctgctcgccgagcgcttcgaccacatcttctacaccggcaacggcaccgtcggccgt
gtcgtcatgcgcgccgccgccgagcacctcaccccggtcaccctcgaactcggcggcaag
tcaccggcgttcgtcgaccgcggcaccgacctcgacgtcgtcgccgaccggctggcccgc
ggcaagttcctcaacgccgggcagacctgtgtcgcccccgactacgtgctgaccgacccg
gagaccgccgccgccctggaacccgcgctcacccgcgccgtcgaagcgctctacggcacc
gaccccgcggcctccggcgcgtacggccggatcgtcaacgaacgccacttcgaccggctc
accggcctgctcgactcgggccgcacggtcgtcggcggcgtcgccgaccgcgccgccaag
tacatcgccccgaccgtgctggcggacgtcgaccccgacgcgccggtcatgcgggaggag
atcttcggccccatcctgccgatcgtcaccgtccccggactggacgaggccgtcgacttc
atcaacgaccgcgacaagccgctggccctgtacgtcttctcggagtccggcgagacccgc
gcccggatcgccgccgagacgtcctccggcggcctcggacacggcctgccgctcgcccat
ctcaccgtctccgacctcccgttcggcggagtgggggagagcggcatgggcagctaccac
ggccgctactccatcgagacgttcagccaccgcaaggcggtcctggaaaagccgctgagc
ccggcccgctga

DBGET integrated database retrieval system