KEGG   Streptomyces sp. CdTB01: AS200_42935Help
Entry
AS200_42935       CDS       T04240                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
scx  Streptomyces sp. CdTB01
Pathway
scx00270  Cysteine and methionine metabolism
scx00920  Sulfur metabolism
scx01100  Metabolic pathways
scx01110  Biosynthesis of secondary metabolites
scx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scx00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AS200_42935
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AS200_42935
Enzymes [BR:scx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AS200_42935
    2.3.1.46  homoserine O-succinyltransferase
     AS200_42935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ALV39103
UniProt: A0A0U3FKM2
Position
complement(9575962..9576993)
Genome map
AA seq 343 aa AA seqDB search
MEAGGELPGVRLAFETWGQPAPDRSNAVLVLHALTGDSHVAGPAEPGHPTPGWWDGLVGP
GLALDTDRWFVVAPNVLGGCQGSTGPSSPRPDGRHWGGAFPFVTQRDQVAAEAGLADALG
IDRWALVIGGSMGGMRAVEWAVSYPERTDALLLLATTAAASAEQIAWADIQLHAIRGDPH
WHGGDYHAKGRGPHTGLGLARRIAHVTYRSEPELQVRFGRNPQHSEDPWQDGRYEVASYL
DHHAAKLVRRFDAGSYVVLSDAMNAHDIGRGRGGTRGALRRVTAKTLVAGVSSDRLYPLT
QQAELAAGISTADEVRVIESPYGHDGFLIEVEQVGALVRELLD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttggaggcagggggcgaactgccgggggtgcggctggcgttcgagacgtgggggcaaccg
gcaccggaccgctccaacgccgtactggtgctccacgcgctcaccggcgacagccacgtc
gccggaccggctgaacccggtcaccccacgcctggctggtgggacggactggtcgggccc
ggactggccctggacacggaccgctggttcgtcgtcgcccccaacgtgctgggcggctgc
cagggaagcaccggcccgtcctcccctcgtcccgacggacggcactggggcggagccttc
ccctttgtgacacagcgcgaccaggtcgccgcggaagccggcctggccgacgcactcggc
atcgaccggtgggccctggtgatcggcggctccatgggcgggatgcgcgccgtggagtgg
gccgtgtcgtatccggagcgcacggacgcgctcctcctcctcgccaccacggcggcggcg
agcgccgaacagatcgcctgggccgacatccagctccacgccatccgcggcgacccccac
tggcacggcggtgactaccacgccaagggccgcggtccgcacacgggactcggcctggcc
cgccgcatcgcccacgtcacctaccgcagcgaaccagagctgcaggttcgcttcggccgc
aacccccagcattccgaagacccttggcaggacggccggtacgaggtcgcgtcctatctc
gaccaccatgccgccaaactggtgcgccgtttcgacgccggcagttacgtcgtcctctcg
gacgccatgaacgcccacgacatcggccgaggccgcggcggtacgcgcggcgccctgcgc
cgggtgaccgccaaaaccctggtcgccggcgtgagttcggatcgtctgtatcccctcacc
cagcaggcggagctcgccgccgggatcagcacggcggacgaggtccgggtgatcgagtcc
ccttacggtcacgacggcttcctcatcgaggtggagcaggtcggtgcgctcgtacgtgaa
cttctggactga

DBGET integrated database retrieval system