KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_11730Help
Entry
SCATT_11730       CDS       T02095                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00340  Histidine metabolism
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01230  Biosynthesis of amino acids
Module
scy_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SCATT_11730
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SCATT_11730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEW93544
UniProt: F8JZW0
Position
complement(1284930..1286249)
Genome map
AA seq 439 aa AA seqDB search
MISRIDLRGTAFPEGGIDRDLLPRAELDVEAALEKVRPICDDVRHRGTAALIEYARRFDG
VTLDRVRVPADALTRALAGLDPAVRAALEESIRRARLVHREQRRTDVTTRVVPGGTVTER
WVPVERVGLYVPGGNAVYPSSVVMNVVPAQEAGVGSLAVSSPPQADFDGLPHPTILAACA
LLGVDEVYAAGGAQAIAMFAHGTEECRPVNLVTGPGNIWVAAAKRLLKGRIGIDAEAGPT
EIAVLADDTADPVHVAADLISQAEHDTLAAAVLVTTSPALADAVAAELDRQVAATKHTER
ITEALTGKQSAVVLVDTLDQGLAVVDAYAAEHLEIQTADAAAVAARVRNAGAVFVGPYAP
VSLGDYAAGSNHVLPTGGCACHSSGLSVQSFLRGIHVVDYTRDALAEVAHHVVTLAEAED
LPAHGAAIKARFEWKVPQG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcccgaatcgatctgcgcggcaccgccttccccgagggcgggatcgaccgcgac
ctgctgccccgtgccgagctcgacgtcgaggccgccctggagaaggtgcgccccatctgc
gacgacgtacggcatcgcggcaccgcggcgctgatcgagtacgcgcggcgcttcgacggc
gtcaccctggaccgcgtccgggtgcccgccgacgccctcacccgggccctggccggactc
gacccggcggtccgcgccgcgctggaggaatccatccggcgcgcccggctcgtccaccgt
gaacagcggcgcaccgacgtcaccacccgcgtcgtccccggcggcaccgtcaccgaacgg
tgggtgccggtcgaacgtgtcggcctgtacgtgcccggtggcaacgcggtctacccgtcg
tccgtggtgatgaacgtggtgccggcgcaggaggccggcgtcggctcgctggccgtctcc
tccccgccgcaggccgacttcgacggcctgccgcaccccaccatcctggccgcctgcgcc
ctgctcggcgtcgacgaggtctacgcggccggcggcgcccaggccatcgccatgttcgcg
cacggcaccgaggagtgccgcccggtcaacctggtcaccggccccggcaacatctgggtg
gccgccgccaagcgcctgctcaaggggcgcatcggcatcgacgccgaggccgggcccacc
gagatcgcggtgctcgccgacgacaccgccgaccccgtccacgtcgccgccgacctgatc
agccaggccgagcacgacacgctggccgccgccgtgctggtcaccacctccccggcgctg
gccgacgccgtcgccgccgaactcgaccgccaggtcgccgccaccaagcacaccgagcgc
atcaccgaggcgctcaccggcaagcagtccgccgtggtgctggtcgacaccctcgaccag
gggctcgccgtggtcgacgcctatgccgccgagcacctggagatccagaccgccgacgcc
gccgcggtcgccgcccgggtccgcaacgccggcgcggtcttcgtcggcccctacgccccc
gtatccctcggcgactacgcggccggctccaaccacgtgctgcccaccggcggctgcgcc
tgccactcctcgggcctttccgtccagtccttcctgcgcggcatccacgtcgtggactac
acccgcgacgccctcgccgaggtcgcccaccacgtggtgaccctcgccgaggcggaggac
ctgcccgcccacggcgccgcgatcaaggcccggttcgagtggaaggtgccgcaggggtga

DBGET integrated database retrieval system