KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_30140Help
Entry
SCATT_30140       CDS       T02095                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00450  Selenocompound metabolism
scy00970  Aminoacyl-tRNA biosynthesis
scy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCATT_30140
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SCATT_30140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scy01007]
    SCATT_30140
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:scy03016]
    SCATT_30140
Enzymes [BR:scy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SCATT_30140
Amino acid related enzymes [BR:scy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SCATT_30140
Transfer RNA biogenesis [BR:scy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SCATT_30140
 Prokaryotic type
   Other AARSs
    SCATT_30140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AEW95385
UniProt: F8JR84
Position
3176580..3178229
Genome map
AA seq 549 aa AA seqDB search
MAATAHEKLDPAERRAPRDGADDATTFYVTTPIYYVNDAPHLGHAYTTVAGDVLSRWHRQ
RGEKVWYLTGTDEHGQKIMRTADANGVTPQEWCDKLVGEAWQPLWKHLEIANDDFIRTTQ
ERHTARVQEFVQDLYDKGEIYRGGYEGPYCVGCEEYKSPGELLDGEDGSKLCPIHKKPVE
MLKEENYFFKLSAYTQRLLDHYEANPGFIQPESARNEVVSFVRQGLEDLSISRSTFDWGI
PVPWDPKHVIYVWVDALLNYATAVGYGSDQAKFEQTFPADVHLVGKDILRFHAVIWPAML
MANGLPLPGKIAANGWLMVGGEKMSKSNLTGISPHQLTEHFGVDAYRWYFLRAIHFGQDG
SFSWEDFSARYTSELANDYGNLASRVAAMVGKYFGGTLPEATAHGDAEQAIADALGRAVA
EADSRIGEKLDFAGGIEAVFDFVKQVNGYLTEQEPWKVAKDSSPEAQARLATILYTAAES
LRAVAVLLNPVMPATSEKLWASLGAAEHLGALADQRVQDAAAWGRLPAGATVTKGEVLFP
RLEDPKKDA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcggccactgcacatgagaagctcgaccccgcggagcggcgcgctccccgcgacggc
gcggacgacgcgacgacgttctacgtcacgacgcccatctactacgtcaacgacgctccg
cacctgggccacgcctacacgaccgtcgcaggcgacgtgctctcccgctggcaccgccag
cgcggcgagaaggtgtggtacctcaccggcaccgacgagcacggtcagaagatcatgcgc
accgccgacgccaacggggtcaccccgcaggagtggtgcgacaagctggtgggcgaggcg
tggcagcccctctggaagcatctggagatcgccaacgacgacttcatccgcaccacgcag
gagcgccacaccgcgcgcgtccaggagttcgtgcaggacctgtacgacaagggcgagatc
taccgcggcggttacgagggcccgtactgcgtggggtgcgaggagtacaagtcccccggt
gagctgctcgacggcgaggacggcagcaagctctgcccgatccacaagaagccggtggag
atgctgaaggaggagaactacttcttcaagctctccgcctacacccagcgcctcctcgac
cactacgaggccaaccccggcttcatccagcccgagtcggcccgcaacgaggtcgtcagc
ttcgtgcggcaggggctggaggacctgtcgatctcccgctcgacgttcgactggggcatc
ccggtgccgtgggaccccaagcacgtcatctacgtgtgggtcgacgcgctgctcaactac
gccaccgccgtcggatacggctccgaccaggccaagttcgagcagaccttcccggccgac
gtgcacctggtcggcaaggacatcctccgcttccacgccgtcatctggccggccatgctg
atggccaacgggctgccgctgccggggaagatcgcggccaacggctggctgatggtcggc
ggcgagaagatgagcaagtccaacctgaccggcatctccccgcaccagctcaccgaacac
ttcggggtggacgcctaccgctggtacttcctgcgggcgatccacttcggccaggacggc
tcgttctcctgggaggacttctccgcccgctacaccagcgaactcgccaacgactacggc
aacttggcgtcccgggtggcggcgatggtcggcaagtacttcggcggcaccctgcccgag
gccaccgcgcacggtgacgccgagcaggcgatcgccgacgcgctgggccgcgcggtggcc
gaggccgacagccggatcggcgagaagctggacttcgccggcggcatcgaggccgtcttc
gacttcgtcaagcaggtcaacggctacctcaccgagcaggagccgtggaaggtcgccaag
gactcctcccccgaggcgcaggcccggttggcgaccatcctgtacaccgccgccgagtcg
ctgcgcgcggtcgcggtcctgctcaacccggtgatgccggccacctccgagaagctgtgg
gcctccctcggcgccgccgagcacctcggcgccctcgccgaccagcgcgtccaggacgcc
gccgcctggggccgcctcccggccggcgccacggtcaccaagggcgaggtcctcttcccc
cgcctggaagaccccaagaaggacgcctga

DBGET integrated database retrieval system