KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_30370Help
Entry
SCATT_30370       CDS       T02095                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00010  Glycolysis / Gluconeogenesis
scy00020  Citrate cycle (TCA cycle)
scy00620  Pyruvate metabolism
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
scy01200  Carbon metabolism
Module
scy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_30370
   00020 Citrate cycle (TCA cycle)
    SCATT_30370
   00620 Pyruvate metabolism
    SCATT_30370
Enzymes [BR:scy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SCATT_30370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AEW95408
UniProt: G8WUB1
Position
complement(3201416..3202822)
Genome map
AA seq 468 aa AA seqDB search
MTMTATGQRFREFRMPDVGEGLTEAEILKWYVTVGDTVTDGQTVCEVETAKAAVELPIPF
DGVVSEIRFPEGTTVDVGTPVIVVDTEPGAGAPAESAPEPAEPEPAPEPEPEPAQPKRQA
VLVGYGVAASSTKRRPRKQQPQGAPAPVVPDVVTKAAGPGGQEAVRPLAKPPVRKLAKDL
GVDLAAVVPTGPDGTVTREDVRAAARPEPAGRAQAPEPAEVPQAPAPAPSAVEPGARETR
VPVKGVRKATAQAMVASAFTAPHVTEFVTFDITRTMRLVQELKGDPAFAGLKVSPLLLVA
KALLVAVKRNPQINAAWDEERQEIVHKHYVNLGIAAATPRGLIVPNIKDAHDKTLPQLAA
ALGDLVTTAREGRTSPADMQGGTLTITNVGVFGVDTGTPILNPGESAILAFGAVKEQPWV
HKGKVKPRQVTTLALSFDHRLVDGELGSKVLADVAAVLEQPKRLMTWA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgaccgcaaccggtcagcgcttccgtgagttcaggatgcccgacgtgggcgag
gggctcaccgaggccgagatcctcaagtggtacgtgacggtgggcgacacggtgaccgac
ggtcagaccgtgtgcgaggtggagaccgccaaggccgccgtcgaactccccatccccttc
gacggggtggtctcggagatccgtttccccgagggcaccacggtggacgtgggcaccccg
gtgatcgtggtggacaccgagcccggcgcgggcgcccccgccgagtcggcgccggagccg
gccgagccggagcccgcgcccgagccggagccggagcccgcccagcccaagcggcaggcg
gtgctcgtcggctacggggtggccgcctcgtccaccaagcgccggccgcgcaagcagcag
ccgcagggcgccccggcccccgtggtccccgacgtggtgaccaaggccgccgggccgggc
ggccaggaggcggtccgcccgctggccaagccgccggtgcgcaagctcgccaaggacctc
ggggtcgacctggccgccgtggtgccgaccgggccggacggcacggtgacccgcgaggac
gtccgggcggcggcgcggcccgagccggccgggcgggcgcaggcgcccgagcccgccgag
gtgccgcaggcgcccgccccggcgccgtcggccgtcgagccgggggcgcgggagacccgg
gtgccggtcaagggcgtccgcaaggcgaccgcgcaggccatggtggccagcgcgttcacc
gcgccgcacgtcaccgagttcgtcaccttcgacatcacccgcaccatgcggctggtgcag
gagctcaagggcgacccggcgttcgccgggctgaaggtgagcccgctgctgctggtcgcc
aaggcgctgctggtcgccgtcaagcgcaacccgcagatcaacgcggcctgggacgaggaa
cgccaggagatcgtccacaagcactacgtcaacctgggcatcgccgcggccaccccgcgt
ggtctgatcgtccccaacatcaaggacgcgcacgacaagacgctgccgcaactggcggcg
gccctcggcgacctggtgaccaccgcccgcgagggccgcacctccccggccgacatgcag
ggcggcaccctcaccatcaccaacgtcggcgtcttcggcgtcgacaccggtacgcccatc
ctcaacccgggggagtccgcgatcctcgccttcggcgcggtcaaggagcagccctgggtg
cacaagggcaaggtgaagccccgccaggtcaccacgctggcgctctccttcgaccaccgg
ctggtcgacggcgagctgggttccaaggtgctggcggacgtggccgccgtactggagcag
cccaagcgcctgatgacctgggcgtga

DBGET integrated database retrieval system