KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_49140Help
Entry
SCATT_49140       CDS       T02095                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00071  Fatty acid degradation
scy00280  Valine, leucine and isoleucine degradation
scy00281  Geraniol degradation
scy00310  Lysine degradation
scy00360  Phenylalanine metabolism
scy00362  Benzoate degradation
scy00380  Tryptophan metabolism
scy00410  beta-Alanine metabolism
scy00627  Aminobenzoate degradation
scy00640  Propanoate metabolism
scy00650  Butanoate metabolism
scy00903  Limonene and pinene degradation
scy00930  Caprolactam degradation
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
scy01212  Fatty acid metabolism
Module
scy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCATT_49140
   00650 Butanoate metabolism
    SCATT_49140
  Lipid metabolism
   00071 Fatty acid degradation
    SCATT_49140
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCATT_49140
   00310 Lysine degradation
    SCATT_49140
   00360 Phenylalanine metabolism
    SCATT_49140
   00380 Tryptophan metabolism
    SCATT_49140
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCATT_49140
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCATT_49140
   00281 Geraniol degradation
    SCATT_49140
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCATT_49140
   00627 Aminobenzoate degradation
    SCATT_49140
   00930 Caprolactam degradation
    SCATT_49140
Enzymes [BR:scy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCATT_49140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEW97285
UniProt: F8JZI4
Position
complement(5309524..5310297)
Genome map
AA seq 257 aa AA seqDB search
MPEAPLVRRDRERGITTLTLDSPHNRNALSARLVGELHEGLAAAAEDRDTRAVLLTHTGN
TFCAGADLSEPAPTGPRELTALLRAVVELPKPVVAVATGHVRAGGLGLLAACDITLAGPA
ATFAFTESRLGLAPAVISLTVLERTEPRAVARYYLTGEVFPVAEAVRIGLVTAGEEALPE
VLAGLRAASPQGLAESKRLTTARVLRAFDRDAAELADRSARLFASAEAAEGMRAFLERRA
PAWSLDGGGGPAAGGRR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggctcccctcgtccgccgcgaccgtgaacgcggcatcaccacgctgaccctg
gactccccgcacaaccgcaacgccctgtcggcccggctggtcggcgagttgcacgagggc
ctggccgcggcggcggaggaccgggacacccgggcggtgctgctcacccacaccggcaac
accttctgcgccggcgccgatctgagcgagccggcgcccaccggcccgcgtgagctgacc
gcgctgctgcgggcggtggtcgaactgcccaagccggtggtcgcggtggccaccggccac
gtccgggcgggcggactcgggctgctggccgcctgcgacatcacgctggccggaccggcg
gccaccttcgcgttcaccgagtcccggctggggctggcgccggcggtgatctcgctgacc
gtgctggagcgcaccgagccgcgcgcggtggcccgttactacctgaccggggaggtcttc
ccggtggccgaggcggtgcggatcgggctggtcacggcgggtgaggaggcgttgccggag
gtgctcgccgggctgcgggcggcctccccgcaggggctggccgagtccaagcggctgacc
acggcacgggtgctgcgcgccttcgaccgggacgcggcggagctggccgatcggtcggcg
cggctgttcgcctcggcggaggcggcggaggggatgcgggcgttcctggagcggcgcgcc
ccggcctggtccctcgacggcggcggtggaccggccgcggggggccggcggtga

DBGET integrated database retrieval system