KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_50990Help
Entry
SCATT_50990       CDS       T02095                                 

Definition
(GenBank) putative fatty acid oxidation complex alpha-subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00071  Fatty acid degradation
scy00280  Valine, leucine and isoleucine degradation
scy00281  Geraniol degradation
scy00310  Lysine degradation
scy00362  Benzoate degradation
scy00380  Tryptophan metabolism
scy00410  beta-Alanine metabolism
scy00640  Propanoate metabolism
scy00650  Butanoate metabolism
scy00903  Limonene and pinene degradation
scy00930  Caprolactam degradation
scy01040  Biosynthesis of unsaturated fatty acids
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
scy01200  Carbon metabolism
scy01212  Fatty acid metabolism
Module
scy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCATT_50990
   00650 Butanoate metabolism
    SCATT_50990
  Lipid metabolism
   00071 Fatty acid degradation
    SCATT_50990
   01040 Biosynthesis of unsaturated fatty acids
    SCATT_50990
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCATT_50990
   00310 Lysine degradation
    SCATT_50990
   00380 Tryptophan metabolism
    SCATT_50990
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCATT_50990
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCATT_50990
   00281 Geraniol degradation
    SCATT_50990
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCATT_50990
   00930 Caprolactam degradation
    SCATT_50990
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SCATT_50990
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCATT_50990
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SCATT_50990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored NAD_binding_8 AlaDh_PNT_C UDPG_MGDP_dh_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AEW97470
UniProt: F8K1H5
Position
5509101..5511275
Genome map
AA seq 724 aa AA seqDB search
MPESTTIRWEQDADGVVTLVLDDPGQSANTMNAAFADSLDAVVGRLESERDTIRGVVVTS
AKKTFFAGGDLRDLIRATPENAAEVFEGGMRVKRLLRRLETLGRPVVAAINGAALGGGYE
IALACHHRVALDAPGSRIGLPEVTLGLLPGSGGVVRTVRLMGIADALLKVLLQGTRYTPR
RAVEAGLVHELAATPEELTAKARAFIDAHPDARQPWDTDGYKIPGGTPAHPAFAANLPAF
PANLSKQLGGAPYPAPRDILAAAVEGSQVDFDTAQVIEARYFTELACGPISKNMIQAFFF
DMQAVNSGASRPAGVEPSTVTRVAVLGAGMMGAGIAYACAKSGLDVVLKDVTAEAAERGK
AYSATLLDKALAKGRTTERERDELLARITPTADTADLAGCDAVIEAVFEDTALKHKVFQE
IEGVVAPDALLCTNTSTLPITLLAEGVQRQEDFIGLHFFSPVDKMPLVEIVKGERTGQTA
LARAFDLVRRIRKTPIVVNDSRGFFTSRVIGQFINEGVAMVGEGVEPASIEQAAAQAGYP
AKVLTLMDELTLTLPRKIRNETRQAVEAAGGTWTAHPAEAVIDRMVDEFGRTGRGGGAGF
YDYADGRRTRLWPGLREHFTRPDADVPFTDIKERMLFAEALDSVRCLEEGVLTSVADANI
GSILGIGFPAWTGGVLQYVNGYEGGLPGFVARARELQAAYGDRFAPPPLLLAKAERGEVF
TDAR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagagcaccacgatccgctgggaacaggacgccgacggtgtcgtcaccctcgtc
ctcgacgaccccggccagtccgccaacaccatgaacgcggccttcgccgactccctcgac
gccgtcgtcggccgcctggagagcgaacgcgacaccatccggggcgtcgtcgtcacctcc
gccaagaagaccttcttcgccggcggcgacctgcgcgacctgatccgcgccacccccgag
aacgccgccgaggtcttcgagggcggcatgcgcgtcaagcggctgctgcgccgcctggag
acgctcggccggccggtcgtcgccgccatcaacggcgcggccctcggcggcggttacgag
atcgccctcgcctgccaccaccgcgtcgccctcgacgcccccggcagccgcatcggcctg
cccgaggtcaccctcggcctgctgcccggcagcggcggcgtggtccgcacggtacggctg
atggggatcgccgacgcgctgctcaaggtgctcctccagggcacccggtacaccccgcgc
cgcgcggtggaggccggcctggtccacgaactcgccgccacgcccgaggagttgacggcc
aaggcccgcgccttcatcgacgcccaccccgacgcccgccagccctgggacaccgacggc
tacaagatccccggcggcaccccggcccaccccgcgttcgccgccaacctccccgccttc
ccggccaacctcagcaagcaactgggcggcgccccctaccccgcgccccgcgacatcctg
gccgccgccgtcgagggctcccaggtcgacttcgacaccgcccaggtcatcgaggcccgc
tacttcaccgaactggcctgcggaccgatctcgaagaacatgatccaggcgttcttcttc
gacatgcaggcggtcaactccggcgcctcccgcccggccggcgtcgagccgtccaccgtc
accagggtcgccgtcctcggcgccggcatgatgggcgccggcatcgcctacgcctgcgcc
aagtccggcctggacgtggtcctcaaggacgtcaccgccgaggccgccgaacgcggcaag
gcgtactcggccaccctgctcgacaaggcgctcgccaaggggcgcaccaccgagagggaa
cgcgacgaactgctggcccggatcacccccaccgccgacaccgccgacctggccggctgc
gacgcggtgatcgaggcggtcttcgaggacaccgccctcaagcacaaggtcttccaggag
atcgagggcgtcgtcgcccccgacgcgctgctgtgcaccaacacctccaccctgccgatc
accctgctcgccgagggcgtccaacgccaggaggacttcatcggcctgcacttcttctca
cccgtggacaagatgccgctggtggagatcgtcaagggcgagcgcaccggacagaccgcg
ctggcccgcgccttcgacctggtccgccggatccgcaagaccccgatcgtggtcaacgac
tcccggggcttcttcacctcccgcgtcatcggccagttcatcaacgagggcgtcgccatg
gtcggcgagggcgtcgaacccgcctcgatcgagcaggccgccgcccaggccggctacccg
gccaaggtgctgacgctgatggacgagctgaccctgaccctgccgcgcaagatccgcaac
gagacccggcaggccgtcgaggcggccggcggcacctggaccgcccaccccgccgaggcc
gtcatcgaccgcatggtcgacgagttcggccgcaccggacgcggcggcggcgccggcttc
tacgactacgccgacggccggcgcaccaggctctggccggggctgcgcgaacacttcacc
cgccccgacgccgacgtccccttcaccgacatcaaggagcggatgctcttcgccgaggcg
ctggactcggtgcgctgcctggaggagggcgtgctgacctcggtcgccgacgccaacatc
ggctccatcctcggcatcggcttccccgcctggaccggcggggtgctccagtacgtcaac
ggctacgagggcggcctgcccggcttcgtagcccgggccagggaactccaggcggcctac
ggcgaccgcttcgccccgccgccgctgctgctggccaaggcggaacgcggcgaggtcttc
accgacgcccgctga

DBGET integrated database retrieval system