KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_56350Help
Entry
SCATT_56350       CDS       T02095                                 

Definition
(GenBank) secreted alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00052  Galactose metabolism
scy00561  Glycerolipid metabolism
scy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCATT_56350
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCATT_56350
   00600 Sphingolipid metabolism
    SCATT_56350
Enzymes [BR:scy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SCATT_56350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Ricin_B_lectin RicinB_lectin_2 Melibiase Melibiase_2_C
Motif
Other DBs
NCBI-ProteinID: AEW98006
UniProt: F8JSU6
Position
complement(6053575..6055185)
Genome map
AA seq 536 aa AA seqDB search
MHVCARPRSLRTGVVLTLLAALLPALAVLGGAGSAHALDDGLARTPPMGWNDWNAFGCSV
TERLVEQTADTMVASGMKDAGYTYVNIDDCWMTHSRDAAGHLVPDPAKFPDGIKGTADYV
HRKGLKLGIYESAGTATCAGYPGSLGHERQDAADFAAWGVDYLKYDNCNNQGVPYQQRYD
AMRDALKATGRPIVYSLCEWGEDSVWTWGAATGHLWRTTGDISASFGSMLSIYRSNVRLA
GYAGPGGWNDPDMLEVGNGMSFTEDRTEFTLWAEMAAPLIAGTDLRTATPATLSLYTNRD
VIAVDQDPLGRQGTEVSSSGGLHVLAKPLAGGDVAVVLFNENAAPATITTSASTAGLPAA
PSYRLTNLWSHQVTSTGGTVSAQVPGHGTVMYRVSVGGGSSVGTTHPLAGASSARCLDVA
GGATTPGTPVDIRDCDGGAWQAWTPTASGELRVYGGTQCLDAYDNRTSPGTPVKLWPCNG
GANQRWNLDPDGTVTGVQSGLCLDVTGGNTPAGNVNGTRVELWDCNGGANQQWRLV
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgtatgcgcccgcccgcgaagcctgcgtaccggcgtcgtactgaccctgctcgcg
gccctgctccccgcgctcgccgtcctcggcggcgcggggagcgcccacgccctggacgac
ggactggccaggaccccgccgatggggtggaacgactggaacgccttcggctgttcggtc
accgagcgactcgtcgagcagaccgccgacacgatggtggcctccggcatgaaggacgcc
ggctacacctacgtcaacatcgacgactgctggatgacccactcccgggacgccgccggc
cacctggtgcccgacccggcgaaattccccgacggcatcaagggcaccgccgactacgtc
caccgcaaggggctcaaactcggcatctacgaaagcgccggcaccgcgacctgcgccggc
taccccggcagcctcggccatgagcgccaggacgcggccgacttcgccgcctggggtgtc
gactacctcaagtacgacaactgcaacaaccagggcgtgccctaccagcagcggtacgac
gccatgcgggacgccctgaaggccaccggccggccgatcgtctacagcctgtgcgagtgg
ggcgaggactcggtctggacctggggcgcggccaccggccatctgtggcggaccaccggg
gacatctcggcctccttcggctccatgctgtcgatctaccgcagcaacgtgcggctcgcc
ggttacgcgggccccggcggctggaacgaccccgacatgctggaggtcggcaacggcatg
tcgttcaccgaggaccgcaccgagttcaccctgtgggccgagatggccgccccgctgatc
gccggcaccgatctgcgcaccgcgaccccggccaccttgtcgctgtacaccaaccgcgac
gtgatcgcggtggaccaggacccgctgggccggcagggcaccgaggtctcctcctccggc
ggcctccacgtcctcgccaagccgctggcgggcggtgatgtcgcggtggtgctcttcaac
gagaacgccgcgccggccaccatcaccaccagcgcctcgaccgcgggcctgccggccgcg
ccctcctaccggctcaccaacctgtggagccaccaggtcaccagcaccggcgggacggtc
tccgcccaggtccccgggcacggcacggtgatgtaccgggtctccgtaggcggcggcagc
agcgtcggcaccacgcatccgctggccggggcctcctcggcgcgctgcctcgacgtggcc
ggcggcgccaccacacccggcaccccggtcgacatccgggactgcgacggcggcgcctgg
caggcgtggaccccgacggcctccggcgaactgcgcgtctacggcggcacccagtgcctg
gacgcctacgacaaccggacctcgccgggcaccccggtcaagctgtggccctgcaacggc
ggcgccaaccagcggtggaacctcgacccggacggcacggtcaccggggtccagtccggc
ctgtgcctcgacgtcaccggcggcaacaccccggccggcaacgtcaacggcacccgcgtg
gaactgtgggactgcaacggcggcgccaaccagcagtggcgactggtctga

DBGET integrated database retrieval system