KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p02480Help
Entry
SCATT_p02480      CDS       T02095                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00020  Citrate cycle (TCA cycle)
scy00310  Lysine degradation
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
scy01200  Carbon metabolism
Module
scy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCATT_p02480
  Amino acid metabolism
   00310 Lysine degradation
    SCATT_p02480
Enzymes [BR:scy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCATT_p02480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl DA1-like
Motif
Other DBs
NCBI-ProteinID: AEW98441
UniProt: F8JKR6
Position
pSCATT:complement(234988..236094)
Genome map
AA seq 368 aa AA seqDB search
MADIRVPKLNNNDTGYQLVAWLVDEDEPVKPDQPVAEVETSKAVEELVSGAEGVLRRLLA
VGDACAPGEVIARVVEPGAPREEPPARPNAVTEAAAEDPGPVVTAPARELMDQLGIDPAR
LRELDVKIVKRADVERLAPEQDSADTRQLPVPQQAVARTVSRSHAEIPAAYTVIAVDAGP
AKAEVARQTTALGRLLGLPELLIAAVARLHAAHPLCFARLTGEHTVRIEERPHIGVTIDV
GKGLNVPVVKDADQLSFAELVEVTTAFRRTAVRGRFRESELSGATIGVTLHNAPDIVHAI
PMIFPGQTCALALSGVRPEVVPDGDGFRARDTVNLGLAYDHRVVNGKDAVDFLQDLKAAL
EHPEELTR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacatccgcgtgcccaaactcaacaacaacgacaccggctaccagctggtggcc
tggctggtcgacgaggacgagccggtcaagcccgaccagccggtggccgaggtggagacc
tccaaggccgtcgaggagctggtgagcggggccgagggcgtcctgcgcagactactcgcg
gtgggtgacgcctgcgcgccgggggaggtcatcgcgcgggtggtcgagcccggcgccccg
cgcgaggagcccccggcacggccgaacgccgtcaccgaggccgccgccgaggaccccggg
ccggtggtcaccgccccggcccgggagctgatggaccaactcggcatcgacccggcccgg
ctgcgcgaactggacgtgaagatcgtcaagcgcgcggacgtcgaacggctcgcccccgaa
caggacagcgccgacacacgccaactgcccgtcccccagcaggcggtggcccgcaccgtg
agccgctcgcacgcggagatcccggccgcctacaccgtcatcgccgtcgacgccggcccg
gccaaggccgaggtggcccggcagaccaccgcgctcggccggctgctgggcctgcccgag
ctgctgatcgcggccgtcgcccggctgcacgccgcgcacccgctgtgcttcgcccggctg
accggcgaacacacggtgcggatcgaggaacggccgcacatcggcgtcaccatcgacgtc
ggcaagggactcaacgtcccggtggtcaaggacgccgaccaactctccttcgccgaactc
gtcgaggtgacgaccgcgttccggcgcaccgcggtgcgcggccggttccgcgagtcggag
ctgtccggcgccaccatcggcgtcaccctgcacaacgcccccgacatcgtgcacgcgatc
cccatgatcttccccgggcagacctgcgcgctggcgctgtccggcgtccggcccgaggtg
gtcccggacggtgacgggttccgcgcccgcgacaccgtcaacctcggactcgcctacgac
caccgggtcgtcaacggcaaggacgcggtggacttcctccaggacctcaaggcggccctg
gagcacccggaggaactcacccgctga

DBGET integrated database retrieval system