KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p06890
Entry
SCATT_p06890      CDS       T02095                                 

Definition
(GenBank) coenzyme PQQ synthesis protein C family protein
  KO
K23670  4-chloro-allylglycine synthase [EC:1.14.99.-]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00997  Biosynthesis of various secondary metabolites - part 3
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
Module
scy_M00906  Ethynylserine biosynthesis, lysine => ethynylserine
Brite
KEGG Orthology (KO) [BR:scy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SCATT_p06890
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.-  
     SCATT_p06890
SSDB
Motif
Pfam: Haem_oxygenas_2 TENA_THI-4 DUF3865
Other DBs
NCBI-ProteinID: AEW98882
UniProt: F8JJ25
Position
pSCATT:682817..683590
AA seq 257 aa
MTDLNTPESTSKPVWEHFDHVEPGIRRRIAVADPEIKEYLDGMLARIASHRGVEHPFLNA
YRTTALDPEQERHLFSECYYFFRYLPFYITGMAVKTRDEMILREIILNVADEVGSDPTHS
TLFADFLARIGIDKEHLDGYQPLEVTRQLNDGIRHLYTETSINKALGALYADETMSSIMV
SKINDGLRNQGYDDDLRHFWQLHIDVEVGHSNSVFNAIAPYVGSKAARAEFEEGVFEFLG
LVERYWDGVRELVGIGK
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaccgacctgaacaccccggaatccacctcgaagccggtgtgggagcacttcgaccac
gtagagccgggaattcggcggcgcatcgccgtggccgacccggaaatcaaggaatacctg
gacggaatgctggcccggatcgcgtcccaccgcggcgtcgagcacccgttcctcaacgcc
taccgcaccacggcactcgacccggagcaggaacgccacctgttcagcgagtgctactac
ttcttccggtacctccccttctacatcacggggatggccgtcaagacgcgggacgagatg
atcctgcgggagatcatcctcaacgtggcggacgaggtcggcagcgacccgacgcactcc
acgctcttcgccgacttcctcgcccggatcggcatcgacaaggaacacctcgacggctac
cagccgctggaggtcacccggcagctcaacgacggcatccggcacctgtacaccgagacg
tcgatcaacaaggcgctcggcgcgctctacgccgacgagaccatgtcctccatcatggtc
tcgaagatcaacgacggcctgcgcaaccaggggtacgacgacgacctgcgccacttctgg
cagctccacatcgacgtcgaggtcggccacagcaactccgtcttcaacgcgatcgcaccg
tacgtcggatcgaaggcggcccgggccgagttcgaggagggcgtcttcgaattcctcgga
ctggtcgaacgctactgggacggcgtgcgggaactcgtgggcatcggcaagtga

DBGET integrated database retrieval system