KEGG   Streptomyces cyaneochromogenes: EJ357_02090
Entry
EJ357_02090       CDS       T06811                                 

Definition
(GenBank) hypothetical protein
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
scya  Streptomyces cyaneochromogenes
Pathway
scya00525  Acarbose and validamycin biosynthesis
scya01100  Metabolic pathways
scya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scya00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    EJ357_02090
Enzymes [BR:scya01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     EJ357_02090
SSDB
Motif
Pfam: AP_endonuc_2 Resolvase
Other DBs
NCBI-ProteinID: AZQ32388
UniProt: A0A3Q9EKS3
Position
543264..544070
AA seq 268 aa
MNCQVALAEWRLPVQGTEALRLARAVGADGVQLDFGGPGRGEWLDTPGRVDALRAEAQST
GVRLLAVAGNHLNDVGLTSRAARPVLERLLDAAAALAVPLVFVPSFRRSAIDSAAAFDRT
AEVLGWAAADAAARGLVLASENVLTGKQARTLVERVASPAFRLVLDTFNPVEAGLSCREL
VAELGEFLADQVHLKDGPPAVGATPPLGTGTGRLDDTLEALREQQVPVRALVLENDYRDG
DRARMLADLHWARQRTRSFVTTRGGNEG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgaactgccaggtggccttggccgaatggcggctgcccgtgcagggaaccgaggcactg
cggctggcccgggccgtcggagccgacggtgtgcaactggacttcggcgggccgggacgc
ggcgagtggctcgacacacccggtcgcgtcgacgcgctgcgtgccgaggcgcagtccacc
ggcgtacggctgctcgcggtggcgggcaaccacctcaacgacgtcggtctgacgtcgcgc
gcggcccgtccggtgctggaacggctcctcgacgccgctgccgcgctcgccgtgcccctg
gtgttcgtgccgagcttccggcgcagtgccatcgacagcgccgccgcgttcgaccgcacg
gccgaggtgctggggtgggccgctgccgacgccgcggcgagaggcctggtgctggccagc
gagaacgtcctcaccggcaaacaggcccgcaccctcgtcgagcgggtggcgtcgcccgcc
ttccgcctggtgctcgacacgttcaacccggtggaggccggcctgtcgtgccgggaactc
gtcgccgaactgggcgagttcctggccgaccaggtccacctcaaggacgggccgccggcc
gtcggcgccaccccgccgctgggcaccggcacgggccggctcgacgacaccctcgaggcg
ctgcgcgagcagcaggtaccggtgcgcgccttggtgctggagaacgactaccgcgacggc
gatcgtgcacggatgctcgccgatctgcactgggcgcggcagcggacgcgctcgttcgtc
acgacccgaggagggaacgaaggatga

DBGET integrated database retrieval system