KEGG   Streptomyces cyaneochromogenes: EJ357_14595
Entry
EJ357_14595       CDS       T06811                                 

Definition
(GenBank) sugar phosphate isomerase/epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
scya  Streptomyces cyaneochromogenes
Pathway
scya00525  Acarbose and validamycin biosynthesis
scya01100  Metabolic pathways
scya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scya00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    EJ357_14595
Enzymes [BR:scya01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     EJ357_14595
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: AZQ34551
UniProt: A0A3Q9ESG9
Position
3274330..3275199
AA seq 289 aa
MTAPAATTVGLTSWRLPAEGAEEAVRHAARLGADGVQLDLGGPGRGPWADAPGTVEAVLR
ARAEAGVALLGLTANTLNDIGLTAPSRSADGTLARVMVVRLLDAAHAYGVPLVFLPSFRR
SAIDTPDDFRRTARILAWAATEADARGLVLANENVLEQERAADLVEKVGSPGFRLLLDPY
NLCVAGRDPVRWVAAVGRYLADQIHLKDGHLRAEKSAALGTGDGRLDDVLAAVAAYGPAP
RALVLENDYRDGDTALPLTDLAWARARAARPTPSPAPAPAPSHRTEAAV
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaccgccccggccgccaccaccgtaggcctcacctcttggcgccttcccgccgagggc
gccgaggaggccgtccggcacgcggcacgcctgggcgccgacggggtgcagctcgacctg
ggcggtccgggccgtggcccgtgggccgacgcccccgggacggtcgaggcggtgctccgg
gcgcgggccgaagcaggcgtcgcgctgctcgggctgaccgccaacacgctgaacgacatc
ggcctcaccgccccttcgcgcagcgccgacggcaccctcgccagggtgatggtcgtacga
ctgctcgacgcggcgcacgcgtacggtgtgccgctggtgttcctgcccagcttccggcgc
agcgccatcgacaccccggacgacttccggcgcaccgcacggatcctggcctgggccgcc
acggaggccgacgcccgcggcctggtgctcgccaacgagaacgtcctggagcaggaacgg
gccgctgacctcgtcgagaaggtcggctcgccgggcttccggctgctgctggacccgtac
aacctgtgcgtggccgggcgcgacccggtgcggtgggtggcggccgtggggcggtacctc
gccgaccagatccatctcaaggacggccacctccgggcggagaagagcgccgcgctcggc
acgggggacggccgtctggacgacgtcctcgccgccgtggccgcgtacggccccgccccg
cgcgccctcgtcctggagaacgactaccgcgacggcgacaccgccctcccgctcacggac
ctcgcctgggcccgggcccgcgccgcccgccccacgccgtcccccgcccccgcccccgcc
ccctcccaccgcaccgaggcagccgtatga

DBGET integrated database retrieval system