KEGG   Streptomyces cyaneochromogenes: EJ357_29930
Entry
EJ357_29930       CDS       T06811                                 

Definition
(GenBank) hydrolase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
scya  Streptomyces cyaneochromogenes
Pathway
scya01057  Biosynthesis of type II polyketide products
scya01100  Metabolic pathways
scya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scya00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    EJ357_29930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:scya01008]
    EJ357_29930
Enzymes [BR:scya01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     EJ357_29930
Polyketide biosynthesis proteins [BR:scya01008]
 Polyketide tailoring proteins
  Oxygenase
   EJ357_29930
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N
Other DBs
NCBI-ProteinID: AZQ37146
UniProt: A0A3Q9EW84
Position
6544490..6545635
AA seq 381 aa
MSGDAMTQERPPLAAGAGRIAELAGKRAADAEQQRRLSPDVVRAVLQAGFAAHFVPVAHG
GRAATFAELVEPVAVLGEACSSTAWYASLTASLGRMAAYLPDEGQAELWAAGPDALIVGA
LMPLGRAERTAGGWHVSGTWPFVSVVDHSDWALVCAMAGQEPWFFAVPRQAYGIVDSWYP
MGMRGTGSNTLVLDGVFVPDARACTRAAIAAGLGPGAEAICHTVPMRAVNGLAFALPMLG
AARGAAAVWTSWIAAKLAGPTGQNAVSSQDRVLYEHTLARATGEIDAAQLLLERVAAVAD
AGGVTGELVGRGARDCALAAELLTAATDRLFASAGTRAQTEDSPLQRFWRDVHAAASHIG
LQFGPGATLYAGELLRRSTDG
NT seq 1146 nt   +upstreamnt  +downstreamnt
gtgagcggggacgcgatgacccaggagcgcccccctctggcggccggggccggccggatc
gccgagctggccgggaagcgggcggccgacgccgagcagcagcgccggctgagccccgat
gtcgtccgcgcggtcctgcaggccggtttcgccgcccacttcgttccggtggcgcacggc
ggcagggccgcgaccttcgccgagctcgtcgagccggtcgcggtgctgggcgaggcctgc
tcgtcgaccgcctggtacgcgtcgctcacggcgagcctcggccggatggccgcctatctg
ccggacgagggccaggccgagctgtgggccgccggccccgacgccctgatcgtcggcgcc
ctgatgccgctcggccgcgccgagcggacggcgggcggctggcatgtctcgggcacctgg
ccgttcgtcagcgtcgtcgaccactccgactgggcgctggtgtgcgccatggcggggcag
gagccgtggttcttcgcggtgccgcggcaggcgtacgggatcgtcgacagctggtacccg
atgggcatgcgtggaacgggcagcaacaccctggtgctcgacggggtgttcgtgccggac
gcgcgggcctgtacccgtgcggccatcgcggccggcctcggtccgggtgccgaggcgatc
tgccacaccgtgcccatgcgggcggtcaacgggctcgccttcgccctgccgatgctcggc
gcggcccgcggcgccgcggccgtgtggacctcgtggatcgccgcgaagctggcggggccg
accgggcagaacgccgtctcctcccaggaccgtgtgctgtacgagcacacgctggcccgg
gccaccggcgagatcgacgcggcccagctgctccttgagcgggtcgccgcggtcgccgac
gccggcggggtgacgggcgaactcgtcggccgtggggcgcgggactgcgccctggcggcc
gagctgctgaccgccgcgaccgaccggctgttcgcctccgcgggcacccgggcacagacg
gaggacagtccgctccagcgcttctggcgcgatgtgcacgcggccgcgagccacatcggg
ctgcagttcgggccgggagcgacgttgtatgccggagagctgctgaggaggagcaccgat
ggctga

DBGET integrated database retrieval system