KEGG   Streptomyces sp. CFMR 7: ABE83_06730Help
Entry
ABE83_06730       CDS       T04074                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
scz  Streptomyces sp. CFMR 7
Pathway
scz00220  Arginine biosynthesis
scz01100  Metabolic pathways
scz01110  Biosynthesis of secondary metabolites
scz01130  Biosynthesis of antibiotics
scz01230  Biosynthesis of amino acids
Module
scz_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:scz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ABE83_06730
Enzymes [BR:scz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     ABE83_06730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ALC26823
UniProt: A0A0M3QLP2
Position
complement(1720404..1721408)
Genome map
AA seq 334 aa AA seqDB search
MAIDLTGRPFLKELDFTAEEFLGLVALAGELKAAKKAGAEVQRLRGKNIALIFEKTSTRT
RCAFEVAAADQGAFTTYLDPSGSQMGHKESVKDTARVLGRMFDGIEYRGDSQQVVEELAA
YGGVPVFNGLTDDWHPTQMLADVLTMTEHSGKPVTDLAFAYLGDARFNMGNSYLITGALL
GLDIRIVAPEMYWPAPSVVAQAEKLAAVSGAKVTLTTDVTEGVRGADFVATDVWVSMGEP
KEVWDERIAALAPYAVTMDVLRATGNPDVKFLHCLPAFHDLGTQVGRDVHAAHGLTELEV
TDEVFESAHSVVFDQAENRMHTIKAVLVATLAGP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgacctcaccggccgccccttcctcaaggagctggacttcaccgccgaggag
ttcctcggcctggtcgcgctggccggtgagctgaaggcggccaagaaggccggggccgag
gtgcagcggctgcgcgggaagaacatcgcgctgatcttcgagaagacctcgacccgtacg
cgctgcgcgttcgaggtcgccgccgccgaccagggcgccttcaccacctacctggatccc
tccggctcccagatgggccacaaggagtcggtgaaggacaccgcccgggtgctcggccgg
atgttcgacgggatcgagtaccggggcgacagccagcaggtggtcgaggaactggccgcg
tacggcggggtcccggtcttcaacgggctcaccgacgactggcaccccacccagatgctg
gccgacgtgctgaccatgaccgagcacagcgggaagcccgtcaccgatctggccttcgcc
tacctcggggacgcccgcttcaacatgggcaactcctacctgatcaccggcgccctgctc
ggcctcgacatccggatcgtcgcccccgagatgtactggccggccccctccgtcgtggcc
caggcggagaagctcgccgccgtcagcggggcgaaggtcacgctcaccaccgacgtcacc
gagggggtccggggcgccgacttcgtcgccacggacgtctgggtctcgatgggggagccc
aaggaggtctgggacgagcgcatcgccgccctcgccccgtacgccgtgacgatggacgtc
ctgcgggccaccggcaacccggacgtcaagttcctgcactgcctgcccgccttccacgac
ctcggcacccaggtcggccgggacgtccacgccgcccacggcctcaccgagctggaggtc
accgacgaggtcttcgagtcggcgcactccgtcgtcttcgaccaggccgagaaccggatg
cacacgatcaaggccgtcctggtggccacgctggcgggcccgtag

DBGET integrated database retrieval system