KEGG   Streptomyces sp. CFMR 7: ABE83_09785Help
Entry
ABE83_09785       CDS       T04074                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
scz  Streptomyces sp. CFMR 7
Pathway
scz00250  Alanine, aspartate and glutamate metabolism
scz00330  Arginine and proline metabolism
scz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ABE83_09785
   00330 Arginine and proline metabolism
    ABE83_09785
Enzymes [BR:scz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     ABE83_09785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALC27348
UniProt: A0A0M5J0S5
Position
complement(2471037..2472668)
Genome map
AA seq 543 aa AA seqDB search
MDAVTQVPAPVNEPVHSYAPGSPERARLEVKLKELSENPIDLPMTIGGEKRMGGGERVNV
VQPHNHKAVIGTFAGATEQDAKDAIDAALAAAPAWRAMSFDDRAAIILRAAELLSGPWRE
TLAASTMLGQSKTAQQAEIDTPCELIDFWRFNVHYARQILAEQPPANSPGVWNRMDHRPL
EGFVYAITPFNFTAIAGNLPTAPALMGNVVVWKPSPTQTHAAVLLMQLLEEAGLPKGVIN
LVTGDGIAVSEVALNHRDLAGIHFTGSTPTFQHLWKTVGNNIANYRTYPRLVGETGGKDF
VVAHPSADRAVLKTALTRGSFEYQGQKCSASSRAYVPASIWNSGFKEEFAAEVDAIKMGD
VTDLTNFIGAVIDDRSFAKNKAAIDRAKSDPACTIVAGGTYDDSVGYFVRPTVIECSDPE
NEVFTTEYFGPILAVHVYEDENYDAMLEQMESVSDYALTGSVIAGDRAAARYTMDKLRYA
AGNFYINDKSTGAVVGQQPFGGGRASGTNDKAGAPQNLQRWTLTRAIKETLVPPTDYTYP
HQG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtcacccaggtccccgcgccggtcaacgagccggttcactcctacgccccg
ggctccccggagcgcgcccgcctggaggtgaagctcaaggagctgagcgagaacccgatc
gacctgccgatgaccatcggcggcgagaagcggatgggcggcggcgagcgggtgaacgtc
gtgcagccgcacaaccacaaggccgtcatcggcaccttcgcgggcgccaccgagcaggac
gcgaaggacgccatcgacgcggccctcgccgccgccccggcctggcgcgcgatgtccttc
gacgaccgcgcggcgatcatcctgcgcgccgccgagctgctgtcgggcccctggcgcgag
acgctggccgcctccaccatgctcggccagtccaagaccgcccagcaggccgagatcgac
accccctgcgagctgatcgacttctggcgcttcaacgtgcactacgcgcgccagatcctc
gccgagcagcccccggccaactccccgggcgtgtggaaccgcatggaccaccgcccgctg
gagggcttcgtctacgcgatcacgccgttcaacttcacggccatcgcgggcaacctcccc
accgccccggccctcatgggcaacgtcgtggtgtggaagccgtccccgacccagacccac
gccgccgtgctgctgatgcagctcctggaggaggccggtctgcccaagggcgtcatcaac
ctggtcaccggtgacggcatcgccgtctccgaggtggcgctcaaccaccgcgacctggcc
ggtatccacttcaccggctcgacccccaccttccagcacctgtggaagacggtcggcaac
aacatcgccaactaccgcacctacccgcggctcgtcggtgagaccggcggcaaggacttc
gtcgtcgcgcacccgagcgccgaccgcgccgtgctgaagaccgcgctgacccgcggctcc
ttcgagtaccagggccagaagtgctccgcgtcctcgcgtgcgtacgtccccgcctccatc
tggaactccggtttcaaggaggagttcgcggccgaggtcgacgccatcaagatgggtgac
gtcaccgacctgacgaacttcatcggcgccgtcatcgacgaccgctcgttcgccaagaac
aaggccgcgatcgaccgcgccaagtccgacccggcgtgcacgatcgtcgcgggcggcacc
tacgacgactcggtgggctacttcgtccgcccgaccgtcatcgagtgctccgaccccgag
aacgaggtcttcacgaccgagtacttcggcccgatcctcgcggtccacgtctacgaggac
gagaactacgacgccatgctggagcagatggagtcggtctcggactacgcgctgaccggc
tcggtcatcgcgggcgaccgcgcggccgcccggtacacgatggacaagctccgctacgcg
gcgggcaacttctacatcaacgacaagtcgaccggcgccgtggtcggccagcagcccttc
ggcggcggccgcgcctccggcaccaacgacaaggcgggcgccccgcagaacctccagcgc
tggaccctgacccgggccatcaaggagaccctggtcccgccgaccgactacacctacccc
caccagggctga

DBGET integrated database retrieval system