KEGG   Streptomyces sp. CFMR 7: ABE83_10140
Entry
ABE83_10140       CDS       T04074                                 

Definition
(GenBank) hypothetical protein
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
scz  Streptomyces sp. CFMR 7
Pathway
scz00525  Acarbose and validamycin biosynthesis
scz01100  Metabolic pathways
scz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scz00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    ABE83_10140
Enzymes [BR:scz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     ABE83_10140
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: ALC27407
UniProt: A0A0M4E3P5
Position
complement(2559443..2560291)
AA seq 282 aa
MSAPPPTGLVDWRLPVRGEAAVDLAFRYRADGLQFDLGGPGRGPRLDGRRGAVERLRRTA
AAAGVAPLGVAANVLNDIGLTADAGTLAAAKVRGVLRRLLDVGEELGAPLVFVPSFRAGA
IDSERALLRTAEVLRPVAARAHARGLLLANENVLPALHAVRLAEEVGSPAFRLLLDTYNP
VAAGLDVPGLVAVTHPWLAGQIHLKDGLAGTTATPLLGDGDGGVGATVDAVARHLRLTAV
VLENDHRDGDGPRLRADLARARAFAGRAAHIQTEMEQPCPSY
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagcgcacctccgccgacgggcctcgtcgactggcggctcccggtgcgcggtgaggcc
gccgtcgacctggccttccggtatcgcgccgacgggctccagttcgacctcggcggcccc
ggccgcggcccccggctcgacggccggcggggtgccgtcgagcggctccgccgcaccgct
gccgctgccggggtggccccgctcggcgttgccgccaacgtcctcaacgacatcggcctc
accgccgatgcgggcaccctggcggccgccaaagtacgcggcgtcctgcgacggctgctg
gacgtcggggaggaactcggcgcccccctggtgttcgtgcccagcttccgggccggtgcc
atcgacagcgagagggcgctgctgcgcaccgccgaggtgctgcggcccgtcgccgcccgg
gcacacgcccgtggtctgctcctggccaacgagaacgtgctgcccgccctgcatgccgtc
cgcctggccgaggaggtcggatcgccggccttccggctgctgctggacacctacaacccg
gtcgccgccggcctcgacgtgcccggtctggtggccgtgacccacccctggctcgccggc
cagatccacctcaaggacggcctcgccggcaccactgccacccccctgctgggcgacggc
gacggcggcgtcggagcgaccgtggacgccgtggcccgccatctgaggctcaccgccgtc
gtcctggagaacgaccaccgcgacggggacggtccacggctccgcgcggacctcgcccgg
gcccgggccttcgccggccgggcggcacacatccagacggagatggagcagccatgcccc
tcgtactga

DBGET integrated database retrieval system