KEGG   Streptomyces sp. CFMR 7: ABE83_13825Help
Entry
ABE83_13825       CDS       T04074                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
scz  Streptomyces sp. CFMR 7
Pathway
scz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:scz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ABE83_13825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:scz03011]
    ABE83_13825
Ribosome [BR:scz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ABE83_13825
  Bacteria
    ABE83_13825
  Archaea
    ABE83_13825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALC28058
UniProt: A0A0M4DL42
Position
complement(3403619..3403966)
Genome map
AA seq 115 aa AA seqDB search
MEARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAH
NYDHTDASTLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVSSKEGTR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagggcccaggcgcggtacatccgcgtcacgcccatgaaggcccgccgcgtg
gtggacctcatccgtggcatggatgccacggaggctcaggcggtcctgcgtttcgccccg
caggccgcgagcgtgccggttggcaaggtgctggacagcgccatcgccaacgccgcacac
aactacgaccacaccgacgcctccacgctggtcatcagcgaggcgtacgtggacgagggc
ccgaccctgaagcggttccgtccgcgtgcccagggccgtgcctaccggatccgtaagcgg
accagccacatcaccgtggtcgtcagcagcaaggaaggaacccggtaa

DBGET integrated database retrieval system