KEGG   Streptomyces sp. CFMR 7: ABE83_19735Help
Entry
ABE83_19735       CDS       T04074                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K22322  A-factor type gamma-butyrolactone 1'-reductase (1S-forming) [EC:1.1.1.413]
Organism
scz  Streptomyces sp. CFMR 7
Brite
KEGG Orthology (KO) [BR:scz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABE83_19735
Enzymes [BR:scz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.413  A-factor type gamma-butyrolactone 1'-reductase (1S-forming)
     ABE83_19735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase ATP-synt_ab DFP 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALC29061
UniProt: A0A0M5ITR9
Position
complement(4685124..4685927)
Genome map
AA seq 267 aa AA seqDB search
MTPGGGPPSGRATPGDGLLSGKVALITGASSGIGAAAARHFADEGAAVVLVARRAALLEE
GAERIRKDGGRAVAVPGDVTRPADMERAVATAVDRFGRLDCAFNNAGHASAGTVLHELPD
EDFDRTLDVNLRGVWNCLRAQLPAMLAAGGGAVVNTSSVAGVRATAASAAYVAAKHAVIG
LTRAAAAEYGEHGIRVNALVVGGTDTEMMDALRPPGPAVGAGFGSRGIQRRLADPVEIAR
AAAWLCSDASSFTTGTALAVDGGRTAK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgggcggaggaccgccgtccggcagagcgacgccgggcgacgggctgctgtcc
ggcaaggtggcgctgatcaccggcgcctccagcgggatcggcgccgcggcggcccggcac
ttcgccgacgagggggccgccgtcgtgctggtggcccgccgggccgccctgctggaggag
ggcgccgagcgcatccggaaggacggcggccgggccgtggccgtaccgggcgacgtcacc
cgccccgcggacatggaacgggccgtggccacggcggtcgaccggttcggccgcctcgac
tgcgcgttcaacaacgccggtcacgccagcgccggaacggtcctgcacgaactccccgac
gaggacttcgaccgcaccctggacgtcaatctgcgcggggtgtggaactgcctgcgcgcc
cagctccccgccatgctggcggcgggcgggggcgcggtcgtcaacacctccagcgtcgcg
ggcgtccgggccaccgccgcgtcggccgcctatgtggccgcgaagcacgcggtcatcggc
ctcaccagggcggcggccgccgagtacggcgagcacggcatccgggtcaacgccctcgtg
gtgggcggcaccgacacggagatgatggacgccctccgcccgcccggccccgccgtgggc
gcgggcttcggctcccggggcatccagcgacggctggccgacccggtcgagatcgcccgt
gccgccgcctggctctgctcggacgcctcctccttcaccaccgggaccgccctcgcggtg
gacggcggccgcaccgccaagtga

DBGET integrated database retrieval system