KEGG   Streptomyces sp. CFMR 7: ABE83_27650Help
Entry
ABE83_27650       CDS       T04074                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
scz  Streptomyces sp. CFMR 7
Pathway
scz00790  Folate biosynthesis
scz01100  Metabolic pathways
scz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABE83_27650
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABE83_27650
Enzymes [BR:scz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ABE83_27650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: ALC30400
UniProt: A0A0M4E8Q3
Position
complement(6594424..6596124)
Genome map
AA seq 566 aa AA seqDB search
MTSRHVPSPSRRTVVRAAAATAAAVPVLATATTAPAASATTTGQDSAARTPAPAFLHGVA
SGDPLPDGVLLWTRVTPEPGAEPGSGRGADTPVRWEVAEDREFTAIAASGTTLAAASSDH
TVKADVRGLRPATTYYYRFTASGPAPEGGEVRSPTGRTRTAPAVGASVAGVRFGVVSCAN
WEAGWFSAYRHLAARGDLDAVVHLGDYLYEYGVGEYPTQGAALREHRPAHEILDLADYRT
RHGNYKTDADLQALHAAHPMIAIWDDHEVANDAWSGGAQNHTPGTEGEWAERVAAAKRAY
FEWMPVRASTEGTVYRRLRFGRLADLHLLDLRSFRSQQASIGSGAVDDPERTITGRAQLD
WLKAGLAGSDAVWKLVGTSVMISPVAFGALPAHLLQPLAGLLGLPKEGLAVNVDQWDGYT
DDRRELIAHLRERGITDTVFLTGDIHMAWANEVPVRAATYPLSPSAATEFVVTSVTSDNL
DDILRVAPQTVSLVAATAVRTANRHVKWVDMDSHGYGVLDVTAERAQMDYYVLSDKKAQD
AAASWTRSYRTRRGTQKVERADRPVR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcgacacgttccctcgccgagccgccgtaccgtcgtccgggccgccgccgcg
accgcagccgccgtccccgtgctcgccaccgcgaccaccgcccccgccgcctccgcgacc
accaccgggcaggactccgccgcccggacccccgccccggccttcctccacggcgtcgcc
tccggggacccgctgcccgacggggtgctgctgtggacccgggtcacccccgagcccggc
gcggagcccggttcggggcgcggggccgacaccccggtgcgttgggaggtggcggaggac
cgggagttcaccgcgatagccgccagcggcacgacgctcgccgccgcctcctccgaccac
accgtgaaggccgacgtccgcggactgcgcccggcgacgacgtactactaccgcttcacg
gcgagcggcccggcccccgagggcggcgaggtccgctcccccaccggccgtacccgcacc
gcgcccgccgtcggagcgagcgtggcgggggtgcgcttcggggtggtgtcctgcgccaac
tgggaggcgggctggttctccgcgtaccgccatctcgccgcccgcggcgacctggacgcg
gtggtgcacctgggcgactacctgtacgagtacggggtcggggagtaccccacccagggc
gcggccctgcgggagcaccgccccgcccacgagatcctggacctggccgactaccgcacc
cggcacgggaactacaagaccgacgccgacctccaggcgctgcacgccgcccacccgatg
atcgcgatctgggacgaccacgaggtcgccaacgacgcctggtcgggcggggcgcagaac
cacaccccgggcacggagggcgagtgggcggagcgggtggcggcggccaagcgggcgtac
ttcgagtggatgccggtccgcgcctccaccgaggggacggtctaccggcggctccggttc
gggcggctggccgatctgcacctgctggacctgcggagcttccgttcgcagcaggcgtcc
atcggcagcggtgcggtggacgacccggagcggacgatcaccggccgggcgcagctggac
tggctgaaggcggggctcgccgggtcggacgcggtgtggaagctcgtcggtacgtcggtg
atgatctccccggtcgccttcggggcgctccccgcccatctgctccagccgctggccggg
ctgctggggctgccgaaggaggggctcgcggtcaacgtcgaccagtgggacgggtacacc
gacgaccgccgggagctgatcgcgcatctgcgggagcgcgggatcaccgacacggtcttc
ctgaccggtgacatccacatggcctgggccaacgaggtgcccgtgcgggcggcgacgtac
ccgctgtcgccctcggcggcgacggagttcgtggtcacgtcggtgacctcggacaacctg
gacgacatcctgcgggtcgcaccgcagaccgtctcgctggtcgccgcgacggccgtccgg
accgccaaccgccatgtgaagtgggtggacatggactcgcacggctacggcgtcctggac
gtcaccgccgagcgcgcgcagatggactactacgtgctctccgacaagaaggcccaggac
gccgccgcctcctggacgcgctcctaccggacccggcgcggcactcagaaggtggagcgg
gcggaccgcccggtccgctga

DBGET integrated database retrieval system