KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0595Help
Entry
GGS_0595          CDS       T02269                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00480  Glutathione metabolism
sda00590  Arachidonic acid metabolism
sda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    GGS_0595 (gpo)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GGS_0595 (gpo)
Enzymes [BR:sda01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GGS_0595 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin FERM_F1
Motif
Other DBs
NCBI-ProteinID: BAM60751
UniProt: M4ZCZ1
Position
complement(606016..606540)
Genome map
AA seq 174 aa AA seqDB search
MIPLTKLSVTPRRCHMPNLYDFTVKAQDGSDISLVNYKEKVVLVVNTATKCGLTPQYQAL
QALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDADP
LFTWLKEEKSGPLGKRIEWNFAKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgataccgttgaccaaattatcagttacaccgaggagatgtcacatgcctaatctctat
gattttacggttaaggctcaggacggcagtgacatctcactagttaactacaaagaaaaa
gtggttttggtcgtgaatacagctaccaaatgtgggctaaccccacaataccaggccttg
caagcactatatgacacataccatgacaagggatttgaggtcttagattttccttgcaac
caatttttaaatcaagctccaggagatgctgaggagattaatcacttttgcagtctgacc
tatcacactactttccctcgctttgcaaaaatcaaagtgaatggtaaagacgctgatcct
ttgttcacctggttaaaagaagaaaaaagtggtccccttgggaaacgcatcgaatggaat
ttcgctaaatttctcattgaccaaaatggtcaagtcattaaacgctattcctcaaagaca
gatcctaaactaattgaagaagaccttaaagcacttcttggttaa

DBGET integrated database retrieval system