KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_0606Help
Entry
GGS_0606          CDS       T02269                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00010  Glycolysis / Gluconeogenesis
sda00051  Fructose and mannose metabolism
sda00562  Inositol phosphate metabolism
sda01100  Metabolic pathways
sda01110  Biosynthesis of secondary metabolites
sda01120  Microbial metabolism in diverse environments
sda01130  Biosynthesis of antibiotics
sda01200  Carbon metabolism
sda01230  Biosynthesis of amino acids
Module
sda_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GGS_0606 (tpiA)
   00051 Fructose and mannose metabolism
    GGS_0606 (tpiA)
   00562 Inositol phosphate metabolism
    GGS_0606 (tpiA)
Enzymes [BR:sda01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GGS_0606 (tpiA)
Exosome [BR:sda04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GGS_0606 (tpiA)
  Exosomal proteins of bladder cancer cells
   GGS_0606 (tpiA)
  Exosomal proteins of melanoma cells
   GGS_0606 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Poxvirus_B22R_C
Motif
Other DBs
NCBI-ProteinID: BAM60762
UniProt: M4YXJ6
Position
619755..620513
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTPQEAKAFVEAVASKLPSNDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENAGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPILCCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVASLVLAYEPIWAIGTGKSAT
QDDAQKMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgccggtaactggaaaatgaacaaaacccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaaacgatcttgtagatgttgcg
gtggcagcgccagctgttgatttggtaacaactatcgaagcagctaaagattcagttctt
aaagttgctgcgcaaaactgctattttgaaaatgcaggagcctttactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactacgttgttattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaacaaaaaagcaaaagctatttttgcgaat
gggttaactccaatcctatgttgtggggaatctcttgaaacttacgaagcaggtaaagct
gttgagtttgttggtgctcaggtttctgcggctcttgcaggtctttctgaagagcaagtg
gcttcacttgttttagcttacgagccaatctgggcaatcggtactggtaaatcagctact
caagatgatgctcaaaaaatgtgtaaagctgtacgtgacgtggttgcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgatggtgcccttgttggtggtgcatcattagaa
gctgatagcttcctcgctttgcttgattttcttaactaa

DBGET integrated database retrieval system