KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1533Help
Entry
GGS_1533          CDS       T02269                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyl transferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00071  Fatty acid degradation
sda00072  Synthesis and degradation of ketone bodies
sda00280  Valine, leucine and isoleucine degradation
sda00310  Lysine degradation
sda00362  Benzoate degradation
sda00380  Tryptophan metabolism
sda00620  Pyruvate metabolism
sda00630  Glyoxylate and dicarboxylate metabolism
sda00640  Propanoate metabolism
sda00650  Butanoate metabolism
sda00900  Terpenoid backbone biosynthesis
sda01100  Metabolic pathways
sda01110  Biosynthesis of secondary metabolites
sda01120  Microbial metabolism in diverse environments
sda01130  Biosynthesis of antibiotics
sda01200  Carbon metabolism
sda01212  Fatty acid metabolism
sda02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GGS_1533 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    GGS_1533 (atoB)
   00640 Propanoate metabolism
    GGS_1533 (atoB)
   00650 Butanoate metabolism
    GGS_1533 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GGS_1533 (atoB)
   00072 Synthesis and degradation of ketone bodies
    GGS_1533 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GGS_1533 (atoB)
   00310 Lysine degradation
    GGS_1533 (atoB)
   00380 Tryptophan metabolism
    GGS_1533 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GGS_1533 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GGS_1533 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GGS_1533 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sda04147]
    GGS_1533 (atoB)
Enzymes [BR:sda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GGS_1533 (atoB)
Exosome [BR:sda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GGS_1533 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: BAM61655
UniProt: M4YYI2
Position
1655763..1656950
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLATQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYAISREEQDQFAL
ESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVARGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagatatggtttgcggttctggacttaaagcaatccaattagctacgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtggaaaacatgtcacag
gcagcctatgtgtcaactcagcaccgctttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggtttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatgccatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctaaggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagatcctttaattgttacgacggatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctggaaatgcctcaggaataaatgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgacttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gtgaatgggggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtggccagaggactagcaacactttgc
attggtggaggtcaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system