KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1572Help
Entry
GGS_1572          CDS       T02269                                 

Gene name
glyQ
Definition
(GenBank) glycyl-tRNA synthetase alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sda00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GGS_1572 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sda01007]
    GGS_1572 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sda03016]
    GGS_1572 (glyQ)
Enzymes [BR:sda01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     GGS_1572 (glyQ)
Amino acid related enzymes [BR:sda01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   GGS_1572 (glyQ)
Transfer RNA biogenesis [BR:sda03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    GGS_1572 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: BAM61693
UniProt: M4YZA4
Position
complement(1702305..1703273)
Genome map
AA seq 322 aa AA seqDB search
MSATNGSCRKKFIMEDTMSKKLTFQEIILTLQQYWNDQGCMLMQAYDNEKGAGTMSPYTF
LRAIGPEPWNAAYVEPSRRPADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLESLEKL
GINPLEHDIRFVEDNWENPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLATSPVTAEVTY
GLERLASYIQEVDSVYDIEWAPGVKYGEIFLQPEYEHSKYSFEVSNQDMLLENFEKFEKE
AARALEEGLVHPAYDYVLKCSHTFNLLDARGAVSVTERAGYIARIRNLARVVAKTFVAER
KKLGFPLLDEETRAALLAEDGE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgtcggcgacaaacggctcctgtcgcaagaaatttataatggaggacactatgtctaaa
aaactgacttttcaagaaatcatcttgaccttacaacaatactggaatgaccaggggtgt
atgctcatgcaggcttatgataatgaaaagggtgctgggaccatgagtccgtataccttc
ctgcgtgctattggtcctgagccatggaatgcggcttatgtagaaccgtcacgtcgtccg
gctgatggtcgttacggggaaaacccaaatcgtctttaccaacaccaccaattccaagtg
gtgatgaaaccatcgccatcaaatattcaagagctctatcttgagtctttggagaaatta
ggtattaaccctttggagcatgacattcgcttcgttgaagataactgggaaaacccgtca
acaggttctgctgggcttggttgggaagtctggctagatgggatggaaatcacgcagttt
acgtacttccaacaagttggtggccttgcaacttctccagtaacagcagaagtaacctat
gggcttgaacgtttggcttcttatattcaagaagttgattcggtttacgatattgaatgg
gcacctggtgttaaatatggtgaaatcttcttgcaacctgagtatgaacattcgaagtac
tcatttgaagtctctaaccaagacatgttgctagaaaattttgagaaatttgaaaaagaa
gcagcgcgtgctttagaagaaggcttggttcacccagcctatgactatgtgcttaaatgt
tcgcatacttttaacttgttagatgctcgtggagcggtttccgtcacagaacgagcaggc
tacattgctcgtatccgtaacttagcacgtgtggttgcaaagacctttgttgcagaacgc
aagaagcttggtttcccactcttggacgaagaaacacgagcagctttactagctgaagat
ggcgaataa

DBGET integrated database retrieval system