KEGG   Streptococcus dysgalactiae subsp. equisimilis RE378: GGS_1663Help
Entry
GGS_1663          CDS       T02269                                 

Gene name
alaT
Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sda  Streptococcus dysgalactiae subsp. equisimilis RE378
Pathway
sda00220  Arginine biosynthesis
sda00250  Alanine, aspartate and glutamate metabolism
sda00290  Valine, leucine and isoleucine biosynthesis
sda01100  Metabolic pathways
sda01110  Biosynthesis of secondary metabolites
sda01130  Biosynthesis of antibiotics
sda01210  2-Oxocarboxylic acid metabolism
sda01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sda00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GGS_1663 (alaT)
   00290 Valine, leucine and isoleucine biosynthesis
    GGS_1663 (alaT)
   00220 Arginine biosynthesis
    GGS_1663 (alaT)
Enzymes [BR:sda01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     GGS_1663 (alaT)
    2.6.1.66  valine---pyruvate transaminase
     GGS_1663 (alaT)
Amino acid related enzymes [BR:sda01007]
 Aminotransferase (transaminase)
  Class I
   GGS_1663 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAM61783
UniProt: M4YZF0
Position
complement(1790864..1792114)
Genome map
AA seq 416 aa AA seqDB search
MVYNMGYEVNETMKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAAFGF
EAPDEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLKGFPEVDIEDIYLGNGVSELI
SMSLQALLDDGDEVLVPMPDYPLWTACVSLGGGKAVHYLCDEEADWYPDIADIKSKITSR
TKAIVVINPNNPTGALYPKEVLEDIVALAREHQLIIFADEIYDRLVMDGEEHVAIASLAP
DVFCVSMNGLSKSHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQT
SLGGRQSVDELLLPGGRIFEQRNFIHEAINAIPGLSAVKPKAGLYLFPKIDRNMYRIDDD
EEFVLQLLKQEKVMLVHGRGFNWKDPDHFRIVYLPTVEELEDVQEKITRVLHQYKR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttggtttataatatgggatacgaggtaaatgagactatgaaaattattgaaaaatcatca
aaattagaacatgtcgcctacgacattcgaggtcctgttttagacgaggccaaccgtatg
attgctaacggtgaaaaaatccttcgattaaacaccggtaacccagcggcttttgggttt
gaggctcctgatgaggtcatccgtgatttgattgtcaatgcgaggcttagtgaagggtat
tcagatagcaagggtatcttttctgcccgcaaagccattatgcaatattgtcagctgaaa
ggtttcccggaggtagatattgaggatatttatttgggaaatggggtgtcagaattaatt
tccatgtcattacaagccctgcttgatgatggggatgaggtgttggttcctatgccagat
taccctctatggacagcctgtgtcagtctgggtggtggcaaagctgtgcattacttgtgt
gatgaagaagcggattggtatcctgacattgctgatatcaaatcaaaaatcacgagtcgc
accaaagctattgtggtcatcaaccctaacaatcccactggtgccctttaccctaaagaa
gtcctagaagatattgttgcccttgcaagagagcaccagctgattatttttgccgatgaa
atctatgaccgattggttatggacggagaggagcatgttgccattgctagtttagcgcca
gatgtattttgtgtatccatgaatggcttatcaaaatcccatcgtattgctggtttccga
gtaggttggatggtcttatctgggccaaaagatcacgtgaaaggctatatcgaaggattg
aatatgctagcgaatatgcgcctctgctccaatgtgttggcccaacaggtagtgcaaaca
tctctaggcggtcgtcagtctgttgatgagctcttgttgccaggtggacgtatttttgag
caacgtaattttatccatgaagccatcaatgcgattccaggcttatctgcagttaaaccc
aaagcaggtctttacctttttcctaagattgatcgtaatatgtatcgtatcgatgatgat
gaagaatttgtgctccaattattaaaacaagaaaaggtgatgttggttcatggccgaggc
ttcaactggaaggacccagaccacttccgaattgtgtacttaccaaccgtggaagaatta
gaagatgttcaggaaaaaatcacccgcgtcttacatcagtacaaacgctaa

DBGET integrated database retrieval system