KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_0068Help
Entry
SDSE_0068         CDS       T02333                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
sdc00260  Glycine, serine and threonine metabolism
sdc00750  Vitamin B6 metabolism
sdc01100  Metabolic pathways
sdc01110  Biosynthesis of secondary metabolites
sdc01120  Microbial metabolism in diverse environments
sdc01230  Biosynthesis of amino acids
Module
sdc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sdc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDSE_0068 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SDSE_0068 (thrC)
Enzymes [BR:sdc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SDSE_0068 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CCI61596
UniProt: K4Q789
Position
60383..61861
Genome map
AA seq 492 aa AA seqDB search
MMYQSTRDQENKVTASQAILQGLAADGGLFTPVSFPKLALSFNKLKDESYQAIAKLVLSA
FFDDFTEDEIEYCISSAYGDKFDTSLIAPVVSLTDSHHLELFHGTTIAFKDMALSILPYL
LTTAAKKQGVEQKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPHAGVSKIQELQMTTQ
VGENTHVVAIEGNFDDAQTDVKRMFNDPDLAQKLAARGMQLSSANSMNIGRLIPQVVYYI
YAYAQLVKAGQIEAGQNINITVPTGNFGNILAAYYAKKIGLPVATFICASNENRVLTDFF
TSGIYDKKRPFKITTSPSMDILVSSNLERLVFHLVGDNAEKTKCLMDTLTRNGSYELQDS
DEAIFSQFVAGFATEAETAAEIKRVFELDDYVMDPHTAVASAVYQNYRHETGDDTPTLIA
STASPYKFPSVVVEAITGEPVADDFEAVSQLKQLSHVVQPKAVIGLQNARVRHRLLVKTA
DMQTAVENYLGL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgatgtaccaatcaacacgagatcaagagaataaagtgacggcaagtcaagctattttg
caaggtttagctgcagatggaggattatttacacctgttagttttcctaagttagcattg
tcatttaacaagcttaaagatgaaagttatcaagccattgccaagctagtgctatccgct
ttttttgatgattttactgaagatgaaattgagtactgtatcagctcagcttatggtgat
aaatttgacacctctcttattgcaccagtagtttctctgacagactctcatcacttggaa
ttgtttcacggaacaacgattgctttcaaagatatggctctgtctattttgccttatctt
ttgaccactgcagctaaaaagcaaggcgtggaacagaaaattgtgattttaacagctact
tctggagatacaggtaaagctgctatggcaggttttgcagatgttcctggaacagaaatt
attgttttttatcctcacgcaggtgttagtaagattcaagaattacaaatgacaactcaa
gttggagaaaatactcacgttgttgccattgaggggaattttgatgatgctcaaacagat
gtgaaacgtatgtttaatgaccctgacttggctcagaaattagcagctcgcgggatgcaa
ctctcatctgcaaactccatgaatattggtcgtcttattccacaagtggtttattatatt
tatgcttatgctcaattggttaaagctggtcagattgaagcaggtcaaaacattaatatt
acggttcctactggtaattttgggaatattttagccgcttattatgccaagaaaattggt
ctacctgtagcaacatttatttgtgcttctaatgagaacagggtcttaacggatttcttt
accagtggtatctatgataaaaaacggcccttcaaaatcacaacaagtccttctatggat
attttggtatcatctaatttagaacgtcttgttttccatttagtaggggataatgctgaa
aaaaccaaatgtttaatggatactctaacaagaaatggatcctacgaattacaagatagt
gatgaggctattttttctcagtttgttgctggttttgccacagaagcagaaacagcggct
gaaattaaacgagtatttgagttagacgattatgttatggatcctcataccgcagttgct
tcggcagtttatcaaaattatcgtcacgagacaggggatgacacaccgacactcattgcc
tcaacagccagtccttataaatttccgagtgttgtagtagaagcaattactggagaaccg
gtcgccgatgactttgaagcagtgagtcaacttaagcagctttctcacgtggtacaacca
aaagctgtgataggattgcaaaacgcaagggttcggcaccgtctgcttgtgaaaacggca
gatatgcagacagctgttgaaaattatcttggtctgtaa

DBGET integrated database retrieval system