KEGG   Streptococcus dysgalactiae subsp. equisimilis AC-2713: SDSE_0591Help
Entry
SDSE_0591         CDS       T02333                                 

Gene name
fadA
Definition
(GenBank) K00626 acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sdc  Streptococcus dysgalactiae subsp. equisimilis AC-2713
Pathway
sdc00071  Fatty acid degradation
sdc00072  Synthesis and degradation of ketone bodies
sdc00280  Valine, leucine and isoleucine degradation
sdc00310  Lysine degradation
sdc00362  Benzoate degradation
sdc00380  Tryptophan metabolism
sdc00620  Pyruvate metabolism
sdc00630  Glyoxylate and dicarboxylate metabolism
sdc00640  Propanoate metabolism
sdc00650  Butanoate metabolism
sdc00900  Terpenoid backbone biosynthesis
sdc01100  Metabolic pathways
sdc01110  Biosynthesis of secondary metabolites
sdc01120  Microbial metabolism in diverse environments
sdc01130  Biosynthesis of antibiotics
sdc01200  Carbon metabolism
sdc01212  Fatty acid metabolism
sdc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sdc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDSE_0591 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    SDSE_0591 (fadA)
   00640 Propanoate metabolism
    SDSE_0591 (fadA)
   00650 Butanoate metabolism
    SDSE_0591 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SDSE_0591 (fadA)
   00072 Synthesis and degradation of ketone bodies
    SDSE_0591 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SDSE_0591 (fadA)
   00310 Lysine degradation
    SDSE_0591 (fadA)
   00380 Tryptophan metabolism
    SDSE_0591 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SDSE_0591 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SDSE_0591 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SDSE_0591 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdc04147]
    SDSE_0591 (fadA)
Enzymes [BR:sdc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SDSE_0591 (fadA)
Exosome [BR:sdc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SDSE_0591 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCI62089
UniProt: K4Q8M7
Position
531772..532887
Genome map
AA seq 371 aa AA seqDB search
MTDIYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPAPIDQVICGNAVGTGGNI
GRLMTLYSHLGEAVPALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGPYKVAQFSPDSNSPFAMIEGAERVAAEYGFTKEYLNHWTLKSHQKASRCQE
QALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEGHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVVTASQVLLAKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPFGASAAIILLHLMKALEIKEGRYGLAAIPAAGGQGIAFL
VEYNQEWCNAN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgacggatatttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaatgctttacaaaataag
tatccagctcctattgaccaagtgatttgtggcaatgccgtcggaactggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaggctgtacctgctttgacggttgat
atgcaatgcgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagtaaccttttagtgggaggaattgaaagtagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggcccttacaaagttgcccagttttctccagatagc
aacagtccatttgcgatgattgagggggcagaacgagtagcagctgagtatggctttact
aaggagtatttgaatcactggacattgaagagtcatcaaaaggctagtcgttgccaggag
caagccctgttagctgatcttattctagacctgccaggtgctagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagagggtcacgtg
attagtgcagccaatgcctgcctcacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaacttattgatgtggtagaagtagcaggagacccacagcgtagc
cccttaatggtggttacagctagtcaagtccttttggcaaagcatggcctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtttatttgaaacc
cattacccagatttattggaccgctataatatatttggaggagctttggcctacgggcat
ccttttggagcttcggcagctattattctcttacatttaatgaaggctttagaaattaag
gaagggcggtatggattggcagctattccagcagcgggagggcagggaattgccttcttg
gtagaatacaatcaggagtggtgcaatgctaactag

DBGET integrated database retrieval system