KEGG   Saccharophagus degradans: Sde_0331
Entry
Sde_0331          CDS       T00335                                 

Definition
(GenBank) protein of unknown function UPF0027
  KO
K18148  release factor H-coupled RctB family protein
Organism
sde  Saccharophagus degradans
Pathway
sde01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sde00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Sde_0331
SSDB
Motif
Pfam: RtcB
Other DBs
NCBI-ProteinID: ABD79595
UniProt: Q21NY4
Position
414273..415505
AA seq 410 aa
MGTVINEVPLHGECSDESGSVCKVRYISSSKNWMESEALQQLTKTSQLQGMRFAVGMPDL
HPGRGNPIGAAFVTQGCIYPHLVGSDIGCGMGLWQLDVKPKQIKIDAWEKRLIGLDDPYQ
GEISDAIANINLNALSVDAGLHNLGTIGGGNHFAEFQKVERVFCQDSFNALALKSQSAFL
LVHSGSRGVGQSILNKYVAESGVSKVDVGTQQFTSYLAAHNAALSWAEANRQLIAKRFMD
CIKTTGKQVLDVNHNTVTPLTAPQALQLAQLLGNKACAAEYWIHRKGASPTHLGPVVIPG
SRGSLSYLVQPLQQNSQHLVNAGFSLAHGAGRKWKRSDVRGRLENKYKVADLENTPLGSR
IVCKQRDLLYEEAPQAYKNIHVVIDDLVQAGVVKIIATLKPLLTYKTRRK
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgggcacagtaataaacgaagtgccgctgcacggcgaatgtagtgacgaaagtggcagc
gtatgtaaggttcgttacatttcatctagtaaaaactggatggaaagcgaagcacttcaa
caattaaccaaaaccagccaactgcaaggcatgcgctttgctgtaggtatgccagattta
cacccgggcagaggtaacccaataggtgcggcgtttgtaacccaaggctgcatatatcca
cacttggtgggtagcgatattggttgcggtatgggtttatggcaattagatgtaaaaccc
aagcaaataaaaatagatgcttgggagaaacgcttaataggcttagacgacccctaccaa
ggcgaaatcagtgatgctatagccaacataaacttaaatgcattaagcgtagatgcaggg
ttgcataacttgggcacaattggtggcggcaaccactttgcagagtttcaaaaagtagag
cgtgtgttttgccaagatagttttaatgcattggcgttaaaaagccaatcggcattttta
cttgtgcattccggttcgcgcggcgtagggcaaagcattcttaataaatatgtggcagaa
agtggcgtaagcaaagtagatgttggtacccaacaatttactagctacttggcggcacat
aacgcagcgcttagttgggcagaagcaaaccgacagttaattgcaaaacgatttatggat
tgcattaaaactaccggcaaacaggtattagatgttaaccacaataccgttacgccatta
acggctccgcaagccttgcagctggcacaacttctaggcaacaaagcctgcgccgccgag
tattggattcatagaaaaggcgcaagcccaacgcatttagggccagtagttattcccggc
tctaggggcagcctaagttatttggtgcaaccgctacagcaaaatagccagcaccttgtt
aatgcaggcttttctctagcgcacggtgcgggccgcaaatggaagcgaagtgacgtaagg
gggcgtttagaaaataaatacaaagtggcagatttagaaaacacgcccctaggtagccgc
attgtgtgtaagcagcgcgatttactgtatgaagaggcaccgcaagcctacaaaaatatt
cacgtagtaatagacgacctagtgcaagcgggtgtagttaaaataattgccaccttaaag
cccctgcttacctataaaacaaggcggaaataa

DBGET integrated database retrieval system