KEGG   Saccharophagus degradans: Sde_0693Help
Entry
Sde_0693          CDS       T00335                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sde  Saccharophagus degradans
Pathway
sde00010  Glycolysis / Gluconeogenesis
sde00051  Fructose and mannose metabolism
sde00562  Inositol phosphate metabolism
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
sde01230  Biosynthesis of amino acids
Module
sde_M00002  Glycolysis, core module involving three-carbon compounds
sde_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_0693
   00051 Fructose and mannose metabolism
    Sde_0693
   00562 Inositol phosphate metabolism
    Sde_0693
Enzymes [BR:sde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sde_0693
Exosome [BR:sde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sde_0693
  Exosomal proteins of bladder cancer cells
   Sde_0693
  Exosomal proteins of melanoma cells
   Sde_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABD79955
UniProt: Q21MX4
Position
complement(895885..896658)
Genome map
AA seq 257 aa AA seqDB search
MNTNTKRKPIVIANWKLNGGLELICTSVASFIGKHFEADIAICPPYIYMRDMLTFLQHSE
ISIGSQNVSKFKSGAYTGETSAQMLKEAGCKLCLIGHSERRSMFKENNLSCQIKIGNALN
HGLMPILCVGENKEEHDAKITKDVIFRQVTECLEGVELDGRKICIAYEPIWAIGTGASAT
PEIAQDVHSFIRQELIKLYGEETANSIRLLYGGSVTKDNAKDLLAKEDVDGLLVGGASLD
PGHFLAICQHASDSSAS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaacaccaaaagaaagccaatagttatagcaaattggaaactcaacggcggc
ctagagctaatctgcacctcggttgcttcgtttataggcaagcacttcgaggcagatatt
gctatttgcccaccctacatttacatgcgcgatatgcttaccttcctgcaacattcagaa
attagcattggcagccaaaacgtaagtaagtttaagtcgggtgcttataccggtgaaacc
tctgcgcaaatgctcaaagaagcaggttgtaagctgtgcttaatcggccactctgagcgc
cgatctatgtttaaagaaaataacctaagctgccaaattaaaattggcaacgcgctaaac
cacggccttatgcccatattgtgcgtaggtgaaaacaaagaagagcacgacgctaaaatc
actaaagatgtgatcttccgtcaggttaccgagtgtttagaaggcgtagagctagatggc
cgtaaaatttgtatcgcttatgaacctatttgggcaataggcaccggcgcctcagctacc
ccagaaattgcacaggatgtacattcgtttattcgacaagaactaataaaattgtacggc
gaagaaaccgctaacagcatccgcttgctgtacggcggcagcgtaaccaaagacaacgcc
aaagacctactcgccaaagaagatgtagacggcctacttgtaggcggcgccagcttagac
ccaggccactttttggctatttgccagcacgcctcagattcttctgctagctaa

DBGET integrated database retrieval system