KEGG   Saccharophagus degradans: Sde_0992Help
Entry
Sde_0992          CDS       T00335                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
sde  Saccharophagus degradans
Pathway
sde00010  Glycolysis / Gluconeogenesis
sde00020  Citrate cycle (TCA cycle)
sde00620  Pyruvate metabolism
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
Module
sde_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_0992
   00020 Citrate cycle (TCA cycle)
    Sde_0992
   00620 Pyruvate metabolism
    Sde_0992
Enzymes [BR:sde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Sde_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ABD80254
UniProt: Q21M25
Position
1271066..1272721
Genome map
AA seq 551 aa AA seqDB search
MALNEQQTNFKIGAPFASDVSVFLANLGISASEIVRNPSYDMLYRNELDENLQGCERGIL
TKTGAVNVDTGVFTGRSPKDKYIVKDEKASANVWWPSDAASNDNHPMDQSTWTRLKAVCT
NQLNNKPLYVVDAFCGASDDVRVSVRFVTEVAWQAHFVTNMFIRPTQAQLDAFTPDFVVL
NASKAVNTQWQQQGLNSENFVAFNLTENMQLIGGTWYGGEMKKGMFSVMNYYLPLHGRAS
MHASANVGSDGDVAVFFGLSGTGKTTLSADPQRALIGDDELGWDDEGVFNLEGGCYAKTI
DLSEQNEPDIFRAIRRDALLENVAVDANGEVDYSDVSKTQNTRVSYPIYHIPNCVKPVSR
GGHARKIIFLTADAFGVFPPVSKLTDEQAQYHFLSGFTSKVAGTELGVTEPSPTFSACFG
EAFLSLHPTVYARELIKRMHANGTQAYLVNTGWNGKGKRISLPDTRAIINAIMDGSIDSA
PCATLPYFNLAFPTQLSGVDSAILDPQVSHNAGGWDVQAKALAKLFATNFKKYTSEALGQ
HLQAVGPAGFE
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcactaaacgagcagcaaacgaattttaaaataggtgcgcctttcgcttctgatgtg
tctgtgtttttagctaatctgggtataagcgcaagcgaaattgtgcgcaaccctagttac
gacatgttgtacaggaatgagttagatgaaaatttacaaggctgcgagcgcggtatttta
accaaaaccggtgcagtgaatgtagatactggcgtttttactggtcggtcgccgaaggat
aaatatattgttaaagatgaaaaagcatcggcgaatgtttggtggcccagcgatgccgcg
tctaacgataaccatcctatggatcaaagtacgtggaccagactaaaagcagtgtgtacc
aatcaacttaataataagccgctgtatgttgtggatgcattttgcggtgccagcgacgat
gtgcgcgtaagtgtacgatttgttacagaggtggcgtggcaggcgcactttgttactaat
atgtttattcgtccgacccaggcgcagcttgatgcgtttactccagactttgttgtgttg
aatgcttccaaggctgtaaatacgcaatggcagcagcaggggttaaactctgaaaatttt
gtagcctttaatttaactgaaaacatgcagcttattggcggcacctggtatggtggcgaa
atgaaaaaaggcatgttctcggtaatgaattattacttgccactacatggccgagcctcc
atgcacgcctctgccaatgttggtagcgatggcgatgtggccgttttctttggcttgtct
ggcacgggcaaaacaacactctcagcagaccctcagcgcgctctcattggcgacgatgag
ttggggtgggatgacgaaggcgtatttaatttagagggcggctgctacgctaaaaccatt
gatttaagtgagcaaaacgaacccgatatctttcgcgcaattcggcgagatgcactgctt
gaaaatgttgcagtggatgcgaatggcgaggtggattatagcgatgtaagtaaaacgcaa
aatacgcgagtgtcttaccctatttatcacattccaaattgcgttaagcctgtgtcacgt
ggtggtcacgcgcgtaaaattatctttcttaccgccgatgcctttggtgtgtttccgcca
gtaagtaagcttaccgacgagcaggcgcagtaccactttttatcgggttttacctcaaag
gtagcgggcaccgagctgggggtaaccgagcctagtcctactttctctgcctgctttggc
gaggcgtttttatctttacaccctacggtttatgcgcgggaattgatcaagcgtatgcat
gcgaatggcacgcaggcttatttggtgaatactggctggaacggcaaggggaagcgcatt
tcattgccagatactcgtgccataatcaacgccattatggatggctctatcgacagtgcc
ccctgcgcgacattgccttattttaatttggcattccctacgcagttgtcaggggtagat
agcgctatcttggacccgcaggtttctcataatgctggaggttgggatgtgcaggcgaaa
gcattggcaaaactatttgccactaattttaaaaaatataccagcgaagccttggggcag
cacttacaagcggtagggccggcggggtttgaataa

DBGET integrated database retrieval system