KEGG   Saccharophagus degradans: Sde_1210Help
Entry
Sde_1210          CDS       T00335                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sde  Saccharophagus degradans
Pathway
sde00260  Glycine, serine and threonine metabolism
sde00750  Vitamin B6 metabolism
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01230  Biosynthesis of amino acids
Module
sde_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sde_1210
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sde_1210
Enzymes [BR:sde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sde_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABD80472
UniProt: Q21LF7
Position
1554008..1555405
Genome map
AA seq 465 aa AA seqDB search
MKYISTRGDAPALSFEDVVLTGLANDGGLYLPETLPKFSAEEIASWRGLDYRELAFKIIS
PFVDGEIPDADLKKLIESAYSKFRHDAIAPLVQTGHNEFILELFQGPTLAFKDFALQFLG
HLFDYVLKKRNQKVVVMGATSGDTGSAAIEGCRDCENIDIFILHPNKRVSDVQRRQMTTV
LTDNVHNIALEGNFDDCQNMVKASFADQSFLPDGRQLVAVNSINWARIMAQIVYYFYAGL
ALGSPARPVSFSVPTGNFGDIFAGYLAKQMGLPIDQLIIATNSNDILHRCISNNDHSKQP
LVHSISPSMDIMVSSNFERMLFDLYDRDGAAIKQLMEDFKSGEMSLAEGPLSKARELFSS
YRLDDKETVDVIREVFENTEYLLDPHTAIGVQAARKQRKSKDVPMVCLATAHPAKFPEAV
RQAGQAADPALPLHMRDLFDREERYTVLENDLAKVHAHMAANINA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatataagtacccgaggggatgccccagctctaagttttgaagacgttgtgtta
accggcttggctaacgatggcggtttatacttgcctgaaacgctacctaaatttagtgcc
gaagaaattgccagttggcgcggtttggattatcgcgagttggctttcaaaattatttcc
ccgtttgttgatggcgaaataccggatgccgatttaaaaaagctaatcgaaagtgcttac
tctaagtttcgtcacgatgcgattgcaccactagtacaaactggccataacgaatttatt
ttagagttgttccaagggccgacgttagcgtttaaagatttcgcgttgcagtttttaggg
cacttgtttgattacgtgcttaaaaagcgcaatcaaaaagttgtggttatgggggcaacc
tctggcgacaccggttcggctgctattgaagggtgtcgtgattgcgaaaatatcgacatc
tttattttgcacccaaacaagcgcgtgtccgatgtacagcgtcgtcagatgactacagtg
cttaccgataatgtgcacaacattgcattagaaggtaattttgacgattgccaaaatatg
gttaaagcgagctttgccgatcaatcgtttttacctgatggccgccagcttgtagcggta
aactctattaactgggcgcgtattatggctcagattgtttactatttttacgccggtttg
gcgttgggctcgccagctcgccctgtgtccttctctgtgccaacgggtaacttcggtgat
atttttgcaggctatttagctaagcaaatgggcttacctatcgatcagctgattattgca
actaacagtaatgatattttgcatcgctgtattagcaataacgaccacagcaaacagcct
ttggtacattcaatttcgccaagtatggatattatggtatccagcaacttcgaacgtatg
ctgtttgatttgtacgaccgcgacggtgcggcgattaaacaattgatggaagactttaag
tctggtgaaatgtctttggctgaaggcccattaagtaaggcgcgagaattgttcagcagc
tatcgtttagacgataaagaaacagttgatgtcattcgcgaagtatttgaaaacactgaa
tacttgttagaccctcacactgcaattggtgtgcaggccgcgcgtaaacagcgcaagtct
aaagatgtgcccatggtatgtcttgcaactgctcacccagctaagttccctgaagccgtg
cgtcaagcgggccaagcggctgaccctgcgttgccattgcatatgcgtgatttatttgat
cgtgaagagcgctacacagttttagagaacgatttagcaaaagtgcacgcgcatatggcg
gcaaatataaacgcttaa

DBGET integrated database retrieval system